NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS48633.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48633.1 Public Mus musculus 10 Tcf3 16 104 75 CCDS HistoryNCBI Gene:21423Re-query CCDS DB by CCDS ID:48633.1Re-query CCDS DB by GeneID:21423See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 48633.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000105343 ENSMUSP00000100980 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105343Link to Ensembl Protein Viewer:ENSMUSP00000100980Re-query CCDS DB by Nucleotide ID:ENSMUST00000105343Re-query CCDS DB by Protein ID:ENSMUSP00000100980
Original member Current member EBI,WTSI OTTMUST00000045823 OTTMUSP00000020641 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000045823Link to Vega Protein Viewer:OTTMUSP00000020641Re-query CCDS DB by Nucleotide ID:OTTMUST00000045823Re-query CCDS DB by Protein ID:OTTMUSP00000020641
Original member Current member NCBI NM_001164152.1 NP_001157624.1 Accepted alive Link to Nucleotide Sequence:NM_001164152.1Link to Protein Sequence:NP_001157624.1Re-query CCDS DB by Nucleotide ID:NM_001164152Re-query CCDS DB by Protein ID:NP_001157624Link to BLink:NP_001157624.1

Chromosomal Locations for CCDS 48633.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 80410132 80410274 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80410398 80410624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80413205 80413337 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80415162 80415288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80415365 80415520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80415853 80415926 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80416560 80416638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80416731 80416789 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80417090 80417225 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80417313 80417470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80417538 80417640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80418766 80418818 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80419467 80419599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80420021 80420088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80421088 80421166 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80421332 80421405 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80427671 80427743 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 80430937 80431011 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1950 nt):
ATGATGAACCAGTCTCAGAGAATGGCACCCGTGGGCTCTGACAAGGAACTGAGTGACCTCCTGGACTTCA
GC
ATGATGTTCCCGCTACCTGTGGCCAATGGGAAGAGCCGGCCCGCCTCCCTCGGGGGAACCCAGTTTGC
A
GGCTCAGGACTGGAGGACCGACCCAGCTCAGGCTCCTGGGGCAGCAGTGACCAGAACAGTTCTTCCTTT
GAC
CCTAGCCGGACATACAGCGAAGGTGCCCACTTCAGTGACTCCCACAGCAGCCTGCCGCCTTCCACGT
TC
CTAGGAGCTGGGCTTGGAGGCAAGGGCAGTGAGCGGAATGCCTATGCCACCTTTGGGAGAGACACCAG
T
GTTGGCACCTTGAGTCAGGCTGGCTTCCTGCCAGGTGAGCTGAGCCTCAGCAGTCCCGGGCCACTGTCC
CCA
TCGGGCATCAAGAGCAGCTCCCAGTATTACCCCTCATTCCCCAGCAACCCTCGTCGGAGAGCTGCAG
AT
GGTGGCCTGGCAGATACTCAGCCGAAGAAGGTCCGGAAGGTTCCGCCTGGTCTCCCTTCCTCGGTGTA
T
CCGCCCAGCTCAGGTGACAGCTACAGCAGGGATGCTGCAGCCTACCCCTCCGCCAAGACCCCCAGCAGC
GCT
TACCCCTCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCATCAGCTGAGCTCTGGAGTACGCCTA
GC
CAGGTGGGCTTTGGGCCCATGCTAGGTGACGGCTCTTCCCCTCTGCCCCTTGCACCGGGCAGCAGCTC
C
GTGGGCAGTGGTACCTTTGGGGGCCTCCAGCAGCAGGATCGCATGGGCTACCAGCTGCATGGATCTGAG
GTT
AATGGCTCGCTCCCAGCTGTATCCAGCTTTTCGGCTGCCCCTGGCACTTACAGTGGGACTTCCGGCC
AC
ACGCCCCCTGTGAGTGGGGCCGCAGCTGAAAGCCTCCTAGGCACCCGAGGGACTACAGCCAGCAGCTC
A
GGGGATGCCCTTGGGAAGGCACTGGCCTCGATCTACTCCCCGGATCACTCCAGCAATAATTTCTCACCT
AGC
CCCTCAACGCCTGTGGGTTCACCCCAGGGCCTGCCAGGGACATCACAGTGGCCCCGGGCAGGAGCGC
CC
AGTGCCTTATCCCCCAACTACGATGCAGGTCTCCATGGCCTGAGCAAGATGGAGGACCGCTTGGACGA
G
GCCATCCATGTCCTGCGAAGCCACGCTGTTGGCACCGCTAGCGATCTCCATGGGCTTTTGCCTGGCCAT
GGC
GCACTGACCACGAGCTTCACCGGCCCCATGTCACTGGGCGGGCGGCATGCCGGCCTGGTCGGGGGAA
GC
CATCCTGAGGAGGGCCTCACAAGTGGGGCCAGTCTTTTGCATAACCATGCCAGCCTCCCCAGCCAGCC
C
AGTTCCCTCCCTGACCTCTCACAGAGACCTCCCGACTCCTATAGTGGACTCGGGAGGGCAGGCACAACA
GCG
GGTGCCAGCGAGATCAAGCGGGAGGAGAAAGAGGATGAGGAAATCGCATCAGTAGCCGACGCCGAAG
AG
GACAAGAAGGACCTGAAGGTCCCACGCACGCGCACCAGCAGTACAGATGAGGTGCTGTCCCTGGAGGA
G
AAGGACCTGAGGGACCGGGAGAGGCGTATGGCCAATAACGCTCGGGAGCGGGTGCGCGTGCGGGACATT
AAC
GAGGCCTTCCGGGAGCTGGGCCGCATGTGCCAGCTGCACCTCAAGTCGGATAAGGCGCAGACCAAGC
TG
CTCATCCTGCAGCAGGCGGTGCAGGTCATCCTGGGCCTGGAGCAGCAGGTGCGAGAACGCAACCTGAA
C
CCCAAAGCAGCCTGCTTGAAGCGGAGGGAGGAGGAGAAGGTGTCTGGCGTGGTCGGGGACCCACAGCTG
GCC
CTGTCAGCCGCCCACCCGGGCCTGGGTGAGGCCCACAACCCAGCCGGGCACCTGTGA


Translation (649 aa):
MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSWGSSDQNSSSF
D
PSR
TYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELSLSSPGPLS
P
SGIKSSSQYYPSFPSNPRRRAADGGL
ADTQPKKVRKVPPGLPSSVYPPSSGDSYSRDAAAYPSAKTPSS
A
YPSPFYVA
DGSLHPSAELWSTPSQVGFGPMLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSE
V
NGSLPAVSSFSAAPGTYSGTSGHTPPVSGAAAESLL
GTRGTTASSSGDALGKALASIYSPDHSSNNFSP
S
PSTPVGSPQGLP
GTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGH
G
ALTTSFTGPMSLGGRHAGL
VGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSYSGLGRAGTT
A
GASEIKREEKEDEEIASVADAEEDKKDLKVPRTRT
SSTDEVLSLEEKDLRDRERRMANNARERVRVRDI
N
EAFRELGRMCQLHLKSDKAQTKLLILQQAVQVILGLEQQVR
ERNLNPKAACLKRREEEKVSGVVGDPQL
A
LSAAHPGLGEAHNPAGHL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser