NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4594.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4594.1 Public Homo sapiens 6 HIST1H2BG 15 105 74 CCDS HistoryNCBI Gene:8339Re-query CCDS DB by CCDS ID:4594.1Re-query CCDS DB by GeneID:8339

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 4594.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000244601 ENSP00000244601 Accepted alive Link to Ensembl Transcript Viewer:ENST00000244601Link to Ensembl Protein Viewer:ENSP00000244601Re-query CCDS DB by Nucleotide ID:ENST00000244601Re-query CCDS DB by Protein ID:ENSP00000244601
Original member Current member EBI,WTSI OTTHUMT00000040109 OTTHUMP00000016160 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000040109Link to Vega Protein Viewer:OTTHUMP00000016160Re-query CCDS DB by Nucleotide ID:OTTHUMT00000040109Re-query CCDS DB by Protein ID:OTTHUMP00000016160
Original member Current member NCBI NM_003518.3 NP_003509.1 Accepted alive Link to Nucleotide Sequence:NM_003518.3Link to Protein Sequence:NP_003509.1Re-query CCDS DB by Nucleotide ID:NM_003518Re-query CCDS DB by Protein ID:NP_003509Link to BLink:NP_003509.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003509.1 126 P62807 126 100% 0 0

Chromosomal Locations for CCDS 4594.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '-' strand of Chromosome 6 (NC_000006.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

Chromosome Start Stop Links
6 26216491 26216871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (381 nt):
ATGCCTGAACCAGCTAAGTCAGCTCCTGCTCCGAAGAAGGGTTCCAAGAAGGCTGTGACCAAGGCGCAGA
AG
AAGGATGGCAAGAAGCGCAAGCGCAGTCGTAAGGAGAGCTACTCCGTGTATGTGTACAAGGTGCTAAA
A
CAGGTTCACCCCGATACTGGCATCTCATCCAAGGCCATGGGCATCATGAATTCCTTCGTTAACGACATC
TTC
GAACGCATCGCAGGCGAGGCTTCCCGTCTGGCCCACTACAACAAGCGCTCGACCATTACCTCCAGGG
AG
ATCCAGACCGCCGTGCGTCTGCTGCTTCCCGGAGAGCTGGCCAAGCACGCAGTGTCCGAAGGTACCAA
G
GCTGTCACCAAGTATACAAGCTCCAAGTAA


Translation (126 aa):
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
F
ERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser