NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS43197.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43197.1 Public Homo sapiens 4 MYL5 18 107 79 CCDS HistoryNCBI Gene:4636Re-query CCDS DB by CCDS ID:43197.1Re-query CCDS DB by GeneID:4636See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Sequence IDs included in CCDS 43197.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000400159 ENSP00000383023 Accepted alive Link to Ensembl Transcript Viewer:ENST00000400159Link to Ensembl Protein Viewer:ENSP00000383023Re-query CCDS DB by Nucleotide ID:ENST00000400159Re-query CCDS DB by Protein ID:ENSP00000383023
Original member Current member EBI,WTSI OTTHUMT00000358570 OTTHUMP00000217187 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000358570Link to Vega Protein Viewer:OTTHUMP00000217187Re-query CCDS DB by Nucleotide ID:OTTHUMT00000358570Re-query CCDS DB by Protein ID:OTTHUMP00000217187
Original member Current member NCBI NM_002477.1 NP_002468.1 Accepted alive Link to Nucleotide Sequence:NM_002477.1Link to Protein Sequence:NP_002468.1Re-query CCDS DB by Nucleotide ID:NM_002477Re-query CCDS DB by Protein ID:NP_002468Link to BLink:NP_002468.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002468.1 173 Q02045-1 173 100% 0 0

Chromosomal Locations for CCDS 43197.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 678027 678029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 678658 678765 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 678958 679033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 679914 680018 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 680509 680587 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 681092 681140 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 681893 681994 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (522 nt):
ATGGCCAGCAGGAAGACCAAGAAGAAGGAAGGGGGTGCCCTCCGGGCCCAGAGAGCCTCATCCAATGTCT
TC
TCCAACTTTGAGCAGACTCAGATCCAGGAGTTCAAGGAGGCATTCACACTCATGGATCAGAACCGAGA
T
GGCTTCATTGACAAGGAGGACCTGAAGGACACCTATGCCTCCCTGGGCAAGACCAACGTCAAGGACGAC
GAG
CTGGACGCCATGCTCAAAGAGGCCTCGGGGCCCATCAACTTCACCATGTTTCTGAACCTGTTTGGGG
AG
AAGCTGAGCGGTACCGACGCCGAGGAGACCATTCTTAACGCCTTCAAGATGCTGGACCCGGACGGGAA
A
GGGAAAATCAACAAGGAGTACATCAAGCGTCTGCTGATGTCCCAGGCTGACAAGATGACGGCGGAAGAG
GTG
GACCAGATGTTCCAGTTCGCCTCCATCGATGTGGCGGGCAACCTGGACTACAAGGCGCTCAGCTACG
TG
ATCACCCACGGGGAGGAGAAGGAGGAGTGA


Translation (173 aa):
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDD
E
LDAMLKEASGPINFTMFLNLFGEKLS
GTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEE
V
DQMFQFASIDVAGNLDYKALSYVITHGEEKEE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser