NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3689.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3689.1 Public Homo sapiens 4 EGF 15 105 74 CCDS HistoryNCBI Gene:1950Re-query CCDS DB by CCDS ID:3689.1Re-query CCDS DB by GeneID:1950

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3689.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000265171 ENSP00000265171 Accepted alive Link to Ensembl Transcript Viewer:ENST00000265171Link to Ensembl Protein Viewer:ENSP00000265171Re-query CCDS DB by Nucleotide ID:ENST00000265171Re-query CCDS DB by Protein ID:ENSP00000265171
Original member Current member EBI,WTSI OTTHUMT00000255065 OTTHUMP00000162922 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000255065Link to Vega Protein Viewer:OTTHUMP00000162922Re-query CCDS DB by Nucleotide ID:OTTHUMT00000255065Re-query CCDS DB by Protein ID:OTTHUMP00000162922
Original member Current member NCBI NM_001963.4 NP_001954.2 Accepted alive Link to Nucleotide Sequence:NM_001963.4Link to Protein Sequence:NP_001954.2Re-query CCDS DB by Nucleotide ID:NM_001963Re-query CCDS DB by Protein ID:NP_001954Link to BLink:NP_001954.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001954.2 1207 P01133-1 1207 100% 0 0

Chromosomal Locations for CCDS 3689.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 4 (NC_000004.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 110834492 110834618 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110862102 110862301 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110864410 110864591 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110864998 110865225 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110866229 110866431 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110880468 110880593 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110882023 110882145 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110883019 110883141 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110884329 110884454 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110885557 110885693 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110890127 110890275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110895859 110895963 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110897168 110897391 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110901128 110901295 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110901982 110902131 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110904578 110904697 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110908900 110909016 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110909740 110909865 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110914403 110914525 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110915889 110916036 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110920835 110921002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110925661 110925778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110929308 110929386 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 110932358 110932611 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3624 nt):
ATGCTGCTCACTCTTATCATTCTGTTGCCAGTAGTTTCAAAATTTAGTTTTGTTAGTCTCTCAGCACCGC
AG
CACTGGAGCTGTCCTGAAGGTACTCTCGCAGGAAATGGGAATTCTACTTGTGTGGGTCCTGCACCCTT
C
TTAATTTTCTCCCATGGAAATAGTATCTTTAGGATTGACACAGAAGGAACCAATTATGAGCAATTGGTG
GTG
GATGCTGGTGTCTCAGTGATCATGGATTTTCATTATAATGAGAAAAGAATCTATTGGGTGGATTTAG
AA
AGACAACTTTTGCAAAGAGTTTTTCTGAATGGGTCAAGGCAAGAGAGAGTATGTAATATAGAGAAAAA
T
GTTTCTGGAATGGCAATAAATTGGATAAATGAAGAAGTTATTTGGTCAAATCAACAGGAAGGAATCATT
ACA
GTAACAGATATGAAAGGAAATAATTCCCACATTCTTTTAAGTGCTTTAAAATATCCTGCAAATGTAG
CA
GTTGATCCAGTAGAAAGGTTTATATTTTGGTCTTCAGAGGTGGCTGGAAGCCTTTATAGAGCAGATCT
C
GATGGTGTGGGAGTGAAGGCTCTGTTGGAGACATCAGAGAAAATAACAGCTGTGTCATTGGATGTGCTT
GAT
AAGCGGCTGTTTTGGATTCAGTACAACAGAGAAGGAAGCAATTCTCTTATTTGCTCCTGTGATTATG
AT
GGAGGTTCTGTCCACATTAGTAAACATCCAACACAGCATAATTTGTTTGCAATGTCCCTTTTTGGTGA
C
CGTATCTTCTATTCAACATGGAAAATGAAGACAATTTGGATAGCCAACAAACACACTGGAAAGGACATG
GTT
AGAATTAACCTCCATTCATCATTTGTACCACTTGGTGAACTGAAAGTAGTGCATCCACTTGCACAAC
CC
AAGGCAGAAGATGACACTTGGGAGCCTGAGCAGAAACTTTGCAAATTGAGGAAAGGAAACTGCAGCAG
C
ACTGTGTGTGGGCAAGACCTCCAGTCACACTTGTGCATGTGTGCAGAGGGATACGCCCTAAGTCGAGAC
CGG
AAGTACTGTGAAGATGTTAATGAATGTGCTTTTTGGAATCATGGCTGTACTCTTGGGTGTAAAAACA
CC
CCTGGATCCTATTACTGCACGTGCCCTGTAGGATTTGTTCTGCTTCCTGATGGGAAACGATGTCATCA
A
CTTGTTTCCTGTCCACGCAATGTGTCTGAATGCAGCCATGACTGTGTTCTGACATCAGAAGGTCCCTTA
TGT
TTCTGTCCTGAAGGCTCAGTGCTTGAGAGAGATGGGAAAACATGTAGCGGTTGTTCCTCACCCGATA
AT
GGTGGATGTAGCCAGCTCTGCGTTCCTCTTAGCCCAGTATCCTGGGAATGTGATTGCTTTCCTGGGTA
T
GACCTACAACTGGATGAAAAAAGCTGTGCAGCTTCAGGACCACAACCATTTTTGCTGTTTGCCAATTCT
CAA
GATATTCGACACATGCATTTTGATGGAACAGACTATGGAACTCTGCTCAGCCAGCAGATGGGAATGG
TT
TATGCCCTAGATCATGACCCTGTGGAAAATAAGATATACTTTGCCCATACAGCCCTGAAGTGGATAGA
G
AGAGCTAATATGGATGGTTCCCAGCGAGAAAGGCTTATTGAGGAAGGAGTAGATGTGCCAGAAGGTCTT
GCT
GTGGACTGGATTGGCCGTAGATTCTATTGGACAGACAGAGGGAAATCTCTGATTGGAAGGAGTGATT
TA
AATGGGAAACGTTCCAAAATAATCACTAAGGAGAACATCTCTCAACCACGAGGAATTGCTGTTCATCC
A
ATGGCCAAGAGATTATTCTGGACTGATACAGGGATTAATCCACGAATTGAAAGTTCTTCCCTCCAAGGC
CTT
GGCCGTCTGGTTATAGCCAGCTCTGATCTAATCTGGCCCAGTGGAATAACGATTGACTTCTTAACTG
AC
AAGTTGTACTGGTGCGATGCCAAGCAGTCTGTGATTGAAATGGCCAATCTGGATGGTTCAAAACGCCG
A
AGACTTACCCAGAATGATGTAGGTCACCCATTTGCTGTAGCAGTGTTTGAGGATTATGTGTGGTTCTCA
GAT
TGGGCTATGCCATCAGTAATGAGAGTAAACAAGAGGACTGGCAAAGATAGAGTACGTCTCCAAGGCA
GC
ATGCTGAAGCCCTCATCACTGGTTGTGGTTCATCCATTGGCAAAACCAGGAGCAGATCCCTGCTTATA
T
CAAAACGGAGGCTGTGAACATATTTGCAAAAAGAGGCTTGGAACTGCTTGGTGTTCGTGTCGTGAAGGT
TTT
ATGAAAGCCTCAGATGGGAAAACGTGTCTGGCTCTGGATGGTCATCAGCTGTTGGCAGGTGGTGAAG
TT
GATCTAAAGAACCAAGTAACACCATTGGACATCTTGTCCAAGACTAGAGTGTCAGAAGATAACATTAC
A
GAATCTCAACACATGCTAGTGGCTGAAATCATGGTGTCAGATCAAGATGACTGTGCTCCTGTGGGATGC
AGC
ATGTATGCTCGGTGTATTTCAGAGGGAGAGGATGCCACATGTCAGTGTTTGAAAGGATTTGCTGGGG
AT
GGAAAACTATGTTCTGATATAGATGAATGTGAGATGGGTGTCCCAGTGTGCCCCCCTGCCTCCTCCAA
G
TGCATCAACACCGAAGGTGGTTATGTCTGCCGGTGCTCAGAAGGCTACCAAGGAGATGGGATTCACTGT
CTT
GATATTGATGAGTGCCAACTGGGGGAGCACAGCTGTGGAGAGAATGCCAGCTGCACAAATACAGAGG
GA
GGCTATACCTGCATGTGTGCTGGACGCCTGTCTGAACCAGGACTGATTTGCCCTGACTCTACTCCACC
C
CCTCACCTCAGGGAAGATGACCACCACTATTCCGTAAGAAATAGTGACTCTGAATGTCCCCTGTCCCAC
GAT
GGGTACTGCCTCCATGATGGTGTGTGCATGTATATTGAAGCATTGGACAAGTATGCATGCAACTGTG
TT
GTTGGCTACATCGGGGAGCGATGTCAGTACCGAGACCTGAAGTGGTGGGAACTGCGCCACGCTGGCCA
C
GGGCAGCAGCAGAAGGTCATCGTGGTGGCTGTCTGCGTGGTGGTGCTTGTCATGCTGCTCCTCCTGAGC
CTG
TGGGGGGCCCACTACTACAGGACTCAGAAGCTGCTATCGAAAAACCCAAAGAATCCTTATGAGGAGT
CG
AGCAGAGATGTGAGGAGTCGCAGGCCTGCTGACACTGAGGATGGGATGTCCTCTTGCCCTCAACCTTG
G
TTTGTGGTTATAAAAGAACACCAAGACCTCAAGAATGGGGGTCAACCAGTGGCTGGTGAGGATGGCCAG
GCA
GCAGATGGGTCAATGCAACCAACTTCATGGAGGCAGGAGCCCCAGTTATGTGGAATGGGCACAGAGC
AA
GGCTGCTGGATTCCAGTATCCAGTGATAAGGGCTCCTGTCCCCAGGTAATGGAGCGAAGCTTTCATAT
G
CCCTCCTATGGGACACAGACCCTTGAAGGGGGTGTCGAGAAGCCCCATTCTCTCCTATCAGCTAACCCA
TTA
TGGCAACAAAGGGCCCTGGACCCACCACACCAAATGGAGCTGACTCAGTGA


Translation (1207 aa):
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRIDTEGTNYEQLV
V
DAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQE
RVCNIEKNVSGMAINWINEEVIWSNQQEGII
T
VTDMKGNNSHILLSALKYPANVAVDPVE
RFIFWSSEVAGSLYRADLDGVGVKALLETSEKITAVSLDVL
D
KRLFWIQYNREGSNSLICSCDYDGGSVHISKHPT
QHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDM
V
RINLHSSFVPLGELKVVHPLAQPKAEDDTWEP
EQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRD
R
KYCE
DVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL
C
FCPEGSVLERDGKTCS
GCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASGPQPFLLFANS
Q
DIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENK
IYFAHTALKWIERANMDGSQRERLIEEGVDVPEGL
A
VDWIGRRFYWTDR
GKSLIGRSDLNGKRSKIITKENISQPRGIAVHPMAKRLFWTDTGINPRIESSSLQG
L
GRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDV
GHPFAVAVFEDYVWFS
D
WAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKP
GADPCLYQNGGCEHICKKRLGTAWCSCREG
F
MKASDGKTCLALDGHQLLA
GGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
S
MYARCISEGEDATCQCLKGFAGDGKLCS
DIDECEMGVPVCPPASSKCINTEGGYVCRCSEGYQGDGIHC
L
DIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSH
D
GYCLHDGVCMYIEALDKYAC
NCVVGYIGERCQYRDLKWWELRHAGHGQQQKVIVVAVCVVVLVMLLLLS
L
WGAHYY
RTQKLLSKNPKNPYEESSRDVRSRRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQ
A
AD
GSMQPTSWRQEPQLCGMGTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANP
L
WQQRALDPPHQMELTQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser