NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15265.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15265.1 Public Mus musculus 1 Il10 19 105 81 CCDS HistoryNCBI Gene:16153Re-query CCDS DB by CCDS ID:15265.1Re-query CCDS DB by GeneID:16153See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15265.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000016673 ENSMUSP00000016673 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000016673Link to Ensembl Protein Viewer:ENSMUSP00000016673Re-query CCDS DB by Nucleotide ID:ENSMUST00000016673Re-query CCDS DB by Protein ID:ENSMUSP00000016673
Original member Current member EBI,WTSI OTTMUST00000040224 OTTMUSP00000017964 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000040224Link to Vega Protein Viewer:OTTMUSP00000017964Re-query CCDS DB by Nucleotide ID:OTTMUST00000040224Re-query CCDS DB by Protein ID:OTTMUSP00000017964
Original member Current member NCBI NM_010548.2 NP_034678.1 Accepted alive Link to Nucleotide Sequence:NM_010548.2Link to Protein Sequence:NP_034678.1Re-query CCDS DB by Nucleotide ID:NM_010548Re-query CCDS DB by Protein ID:NP_034678Link to BLink:NP_034678.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034678.1 178 P18893 178 100% 0 0

Chromosomal Locations for CCDS 15265.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 131019912 131020076 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 131020964 131021023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 131021329 131021481 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 131022489 131022554 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 131024176 131024268 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (537 nt):
ATGCCTGGCTCAGCACTGCTATGCTGCCTGCTCTTACTGACTGGCATGAGGATCAGCAGGGGCCAGTACA
GC
CGGGAAGACAATAACTGCACCCACTTCCCAGTCGGCCAGAGCCACATGCTCCTAGAGCTGCGGACTGC
C
TTCAGCCAGGTGAAGACTTTCTTTCAAACAAAGGACCAGCTGGACAACATACTGCTAACCGACTCCTTA
ATG
CAGGACTTTAAGGGTTACTTGGGTTGCCAAGCCTTATCGGAAATGATCCAGTTTTACCTGGTAGAAG
TG
ATGCCCCAGGCAGAGAAGCATGGCCCAGAAATCAAGGAGCATTTGAATTCCCTGGGTGAGAAGCTGAA
G
ACCCTCAGGATGCGGCTGAGGCGCTGTCATCGATTTCTCCCCTGTGAAAATAAGAGCAAGGCAGTGGAG
CAG
GTGAAGAGTGATTTTAATAAGCTCCAAGACCAAGGTGTCTACAAGGCCATGAATGAATTTGACATCT
TC
ATCAACTGCATAGAAGCATACATGATGATCAAAATGAAAAGCTAA


Translation (178 aa):
MPGSALLCCLLLLTGMRISRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSL
M
QDFK
GYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVE
Q
VKSDFNK
LQDQGVYKAMNEFDIFINCIEAYMMIKMKS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser