NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS14256.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14256.1 Public Homo sapiens X NYX 18 107 79 CCDS HistoryNCBI Gene:60506Re-query CCDS DB by CCDS ID:14256.1Re-query CCDS DB by GeneID:60506See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 14256.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000342595 ENSP00000340328 Accepted alive Link to Ensembl Transcript Viewer:ENST00000342595Link to Ensembl Protein Viewer:ENSP00000340328Re-query CCDS DB by Nucleotide ID:ENST00000342595Re-query CCDS DB by Protein ID:ENSP00000340328
Original member Current member EBI,WTSI ENST00000378220 ENSP00000367465 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378220Link to Ensembl Protein Viewer:ENSP00000367465Re-query CCDS DB by Nucleotide ID:ENST00000378220Re-query CCDS DB by Protein ID:ENSP00000367465
Original member Current member EBI,WTSI OTTHUMT00000056256 OTTHUMP00000023145 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000056256Link to Vega Protein Viewer:OTTHUMP00000023145Re-query CCDS DB by Nucleotide ID:OTTHUMT00000056256Re-query CCDS DB by Protein ID:OTTHUMP00000023145
Original member Current member EBI,WTSI OTTHUMT00000056257 OTTHUMP00000023146 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000056257Link to Vega Protein Viewer:OTTHUMP00000023146Re-query CCDS DB by Nucleotide ID:OTTHUMT00000056257Re-query CCDS DB by Protein ID:OTTHUMP00000023146
Original member Current member NCBI NM_022567.2 NP_072089.1 Accepted alive Link to Nucleotide Sequence:NM_022567.2Link to Protein Sequence:NP_072089.1Re-query CCDS DB by Nucleotide ID:NM_022567Re-query CCDS DB by Protein ID:NP_072089Link to BLink:NP_072089.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_072089.1 481 Q9GZU5 481 100% 0 0

Chromosomal Locations for CCDS 14256.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 41447890 41447926 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 41473491 41474899 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1446 nt):
ATGAAAGGCCGAGGGATGTTGGTCCTGCTTCTGCATGCGGTGGTCCTCGGCCTGCCCAGCGCCTGGGCCG
TG
GGGGCCTGCGCCCGCGCTTGTCCCGCCGCCTGCGCCTGCAGCACCGTGGAGCGCGGCTGCTCGGTGCG
C
TGCGACCGCGCGGGCCTCCTGCGGGTGCCGGCCGAGCTCCCGTGCGAGGCGGTCTCCATCGACCTGGAC
CGG
AACGGCCTGCGCTTCCTGGGCGAGCGAGCCTTCGGCACGCTGCCGTCCTTGCGCCGCCTGTCGCTGC
GC
CACAACAACCTGTCCTTCATCACGCCCGGCGCCTTCAAGGGCCTGCCGCGCCTGGCTGAGCTGCGCCT
G
GCGCACAACGGCGACCTGCGCTACCTGCACGCGCGCACCTTCGCGGCGCTCAGCCGCCTGCGCCGCCTA
GAC
CTAGCAGCCTGCCGCCTCTTCAGCGTGCCCGAGCGCCTCCTGGCCGAACTGCCGGCCCTGCGCGAAC
TC
GCCGCCTTCGACAACCTGTTCCGCCGCGTGCCGGGCGCGCTGCGCGGCCTGGCCAACCTGACGCACGC
G
CACCTGGAGCGCGGCCGCATCGAGGCGGTGGCCTCCAGCTCGCTGCAGGGCCTGCGCCGCCTGCGCTCG
CTC
AGCCTGCAGGCCAACCGCGTCCGTGCCGTGCACGCTGGCGCCTTCGGGGACTGTGGCGTCCTGGAGC
AT
CTGCTGCTCAACGACAACCTGCTGGCCGAGCTCCCGGCCGACGCCTTCCGCGGCCTGCGGCGCCTGCG
C
ACGCTCAACCTGGGTGGCAACGCGCTGGACCGCGTGGCGCGCGCCTGGTTCGCTGACCTGGCCGAGCTC
GAG
CTGCTCTACCTGGACCGCAACAGCATCGCCTTCGTGGAGGAGGGCGCCTTCCAGAACCTCTCGGGTC
TC
CTCGCGCTGCACCTCAACGGCAACCGCCTCACCGTGCTCGCCTGGGTCGCCTTCCAGCCCGGCTTCTT
C
CTGGGCCGCCTCTTCCTCTTCCGCAACCCGTGGTGCTGCGACTGCCGTCTGGAGTGGCTGAGGGACTGG
ATG
GAGGGCTCCGGACGTGTCACCGACGTGCCGTGCGCCTCCCCGGGCTCCGTGGCCGGCCTGGACCTCA
GC
CAGGTGACCTTCGGGCGCTCCTCCGATGGCCTCTGTGTGGACCCCGAGGAGCTGAACCTCACCACGTC
C
AGTCCAGGCCCGTCCCCAGAACCAGCGGCCACCACCGTGAGCAGGTTCAGCAGCCTCCTCTCCAAGCTG
CTG
GCCCCGAGGGTCCCGGTGGAGGAGGCGGCCAACACCACTGGGGGGCTGGCCAACGCCTCCCTGTCCG
AC
AGCCTCTCCTCCCGTGGGGTGGGAGGCGCGGGCCGGCAGCCCTGGTTTCTCCTCGCCTCTTGTCTCCT
G
CCCAGCGTGGCCCAGCACGTGGTGTTTGGCCTGCAGATGGACTGA


Translation (481 aa):
MKGRGMLVLLLHAVVLGLPSAWAVGACARACPAACACSTVERGCSVRCDRAGLLRVPAELPCEAVSIDLD
R
NGLRFLGERAFGTLPSLRRLSLRHNNLSFITPGAFKGLPRLAELRLAHNGDLRYLHARTFAALSRLRRL
D
LAACRLFSVPERLLAELPALRELAAFDNLFRRVPGALRGLANLTHAHLERGRIEAVASSSLQGLRRLRS
L
SLQANRVRAVHAGAFGDCGVLEHLLLNDNLLAELPADAFRGLRRLRTLNLGGNALDRVARAWFADLAEL
E
LLYLDRNSIAFVEEGAFQNLSGLLALHLNGNRLTVLAWVAFQPGFFLGRLFLFRNPWCCDCRLEWLRDW
M
EGSGRVTDVPCASPGSVAGLDLSQVTFGRSSDGLCVDPEELNLTTSSPGPSPEPAATTVSRFSSLLSKL
L
APRVPVEEAANTTGGLANASLSDSLSSRGVGGAGRQPWFLLASCLLPSVAQHVVFGLQMD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser