NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS12691.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
12691.1 Public Homo sapiens 19 FKRP 15 105 74 CCDS HistoryNCBI Gene:79147Re-query CCDS DB by CCDS ID:12691.1Re-query CCDS DB by GeneID:79147

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 12691.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000318584 ENSP00000326570 Accepted alive Link to Ensembl Transcript Viewer:ENST00000318584Link to Ensembl Protein Viewer:ENSP00000326570Re-query CCDS DB by Nucleotide ID:ENST00000318584Re-query CCDS DB by Protein ID:ENSP00000326570
Original member Current member EBI,WTSI ENST00000391909 ENSP00000375776 Accepted alive Link to Ensembl Transcript Viewer:ENST00000391909Link to Ensembl Protein Viewer:ENSP00000375776Re-query CCDS DB by Nucleotide ID:ENST00000391909Re-query CCDS DB by Protein ID:ENSP00000375776
Original member Current member EBI,WTSI OTTHUMT00000465473 OTTHUMP00000271078 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000465473Link to Vega Protein Viewer:OTTHUMP00000271078Re-query CCDS DB by Nucleotide ID:OTTHUMT00000465473Re-query CCDS DB by Protein ID:OTTHUMP00000271078
Original member Current member EBI,WTSI OTTHUMT00000465480 OTTHUMP00000271083 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000465480Link to Vega Protein Viewer:OTTHUMP00000271083Re-query CCDS DB by Nucleotide ID:OTTHUMT00000465480Re-query CCDS DB by Protein ID:OTTHUMP00000271083
Original member Current member NCBI NM_001039885.2 NP_001034974.1 Accepted alive Link to Nucleotide Sequence:NM_001039885.2Link to Protein Sequence:NP_001034974.1Re-query CCDS DB by Nucleotide ID:NM_001039885Re-query CCDS DB by Protein ID:NP_001034974Link to BLink:NP_001034974.1
Original member Current member NCBI NM_024301.4 NP_077277.1 Accepted alive Link to Nucleotide Sequence:NM_024301.4Link to Protein Sequence:NP_077277.1Re-query CCDS DB by Nucleotide ID:NM_024301Re-query CCDS DB by Protein ID:NP_077277Link to BLink:NP_077277.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001034974.1 495 Q9H9S5 495 100% 0 0
NP_077277.1 495 Q9H9S5 495 100% 0 0

Chromosomal Locations for CCDS 12691.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 19 (NC_000019.9)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

Chromosome Start Stop Links
19 47258708 47260195 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1488 nt):
ATGCGGCTCACCCGCTGCCAGGCTGCCCTGGCGGCCGCCATCACCCTCAACCTTCTGGTCCTCTTCTATG
TC
TCGTGGCTGCAGCACCAGCCTAGGAATTCCCGGGCCCGGGGGCCCCGTCGTGCCTCTGCTGCCGGCCC
C
CGTGTCACCGTCCTGGTGCGGGAGTTCGAGGCATTTGACAACGCGGTGCCCGAGCTGGTAGACTCCTTC
CTG
CAGCAAGACCCAGCCCAGCCCGTGGTGGTGGCAGCCGACACGCTCCCCTACCCGCCCCTGGCCCTGC
CC
CGCATCCCCAACGTGCGTCTGGCGCTGCTCCAGCCCGCCCTGGACCGGCCAGCCGCAGCCTCGCGCCC
G
GAGACCTACGTGGCCACCGAGTTTGTGGCCCTAGTACCTGATGGGGCGCGGGCTGAGGCACCTGGCCTG
CTG
GAGCGCATGGTGGAGGCGCTCCGCGCAGGAAGCGCACGTCTGGTGGCCGCCCCGGTTGCCACGGCCA
AC
CCTGCCAGGTGCCTGGCCCTGAACGTCAGCCTGCGAGAGTGGACCGCCCGCTATGGCGCAGCCCCCGC
C
GCGCCCCGCTGCGACGCCCTGGACGGAGATGCTGTGGTGCTCCTGCGCGCCCGCGACCTCTTCAACCTC
TCG
GCGCCCCTGGCCCGGCCGGTGGGCACCAGCCTCTTTCTGCAGACCGCCCTTCGCGGCTGGGCGGTGC
AG
CTGCTGGACTTGACCTTCGCCGCGGCGCGCCAGCCCCCGCTGGCCACGGCCCACGCGCGCTGGAAGGC
T
GAGCGCGAGGGACGCGCTCGGCGGGCGGCGCTGCTCCGCGCGCTGGGCATCCGCCTAGTGAGCTGGGAA
GGC
GGGCGGCTGGAGTGGTTCGGCTGCAACAAGGAGACCACGCGCTGCTTCGGAACCGTGGTGGGCGACA
CG
CCCGCCTACCTCTACGAGGAGCGCTGGACGCCCCCCTGCTGCCTGCGCGCGCTGCGCGAGACCGCCCG
C
TATGTGGTGGGCGTGCTGGAGGCTGCGGGCGTGCGCTACTGGCTCGAGGGCGGCTCACTGCTGGGGGCC
GCC
CGCCACGGGGACATCATCCCATGGGACTACGACGTGGACCTGGGCATCTACTTGGAGGACGTGGGCA
AC
TGCGAGCAGCTGCGGGGGGCAGAGGCCGGCTCGGTGGTGGATGAGCGCGGCTTCGTATGGGAGAAGGC
G
GTCGAGGGCGACTTTTTCCGCGTGCAGTACAGCGAAAGCAACCACTTGCACGTGGACCTGTGGCCCTTC
TAC
CCCCGCAATGGCGTCATGACCAAGGACACGTGGCTGGACCACCGGCAGGATGTGGAGTTTCCCGAGC
AC
TTCCTGCAGCCGCTGGTGCCCCTGCCCTTTGCCGGCTTCGTGGCGCAGGCGCCTAACAACTACCGCCG
C
TTCCTGGAGCTCAAGTTCGGGCCCGGGGTCATCGAGAACCCCCAGTACCCCAACCCGGCACTGCTGAGT
CTG
ACGGGAAGCGGCTGA


Translation (495 aa):
MRLTRCQAALAAAITLNLLVLFYVSWLQHQPRNSRARGPRRASAAGPRVTVLVREFEAFDNAVPELVDSF
L
QQDPAQPVVVAADTLPYPPLALPRIPNVRLALLQPALDRPAAASRPETYVATEFVALVPDGARAEAPGL
L
ERMVEALRAGSARLVAAPVATANPARCLALNVSLREWTARYGAAPAAPRCDALDGDAVVLLRARDLFNL
S
APLARPVGTSLFLQTALRGWAVQLLDLTFAAARQPPLATAHARWKAEREGRARRAALLRALGIRLVSWE
G
GRLEWFGCNKETTRCFGTVVGDTPAYLYEERWTPPCCLRALRETARYVVGVLEAAGVRYWLEGGSLLGA
A
RHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDFFRVQYSESNHLHVDLWPF
Y
PRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFVAQAPNNYRRFLELKFGPGVIENPQYPNPALLS
L
TGSG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser