NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11051.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11051.1 Public Homo sapiens 17 ARRB2 18 107 79 CCDS HistoryNCBI Gene:409Re-query CCDS DB by CCDS ID:11051.1Re-query CCDS DB by GeneID:409See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 11051.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000381488 ENSP00000370898 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381488Link to Ensembl Protein Viewer:ENSP00000370898Re-query CCDS DB by Nucleotide ID:ENST00000381488Re-query CCDS DB by Protein ID:ENSP00000370898
Original member Current member EBI,WTSI OTTHUMT00000439564 OTTHUMP00000257974 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000439564Link to Vega Protein Viewer:OTTHUMP00000257974Re-query CCDS DB by Nucleotide ID:OTTHUMT00000439564Re-query CCDS DB by Protein ID:OTTHUMP00000257974
Original member Current member NCBI NM_199004.1 NP_945355.1 Accepted alive Link to Nucleotide Sequence:NM_199004.1Link to Protein Sequence:NP_945355.1Re-query CCDS DB by Nucleotide ID:NM_199004Re-query CCDS DB by Protein ID:NP_945355Link to BLink:NP_945355.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_945355.1 394 P32121-5 394 100% 0 0

Chromosomal Locations for CCDS 11051.1

Assembly GRCh38.p2 (GCF_000001405.28)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 4710722 4710744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4715013 4715043 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4715973 4716033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4716412 4716608 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4717217 4717276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4717685 4717752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4717888 4718023 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4718261 4718345 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4718612 4718684 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4719283 4719420 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4720216 4720299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4720393 4720472 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4720586 4720640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 4720946 4721039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1185 nt):
ATGGGGGAGAAACCCGGGACCAGGGTCTTCAAGAAGTCGAGCCCTAACTGCAAGCTCACCGTGTACTTGG
GC
AAGCGGGACTTCGTAGATCACCTGGACAAAGTGGACCCTGTAGTGTTTGTGACCCTCACCTGCGCCTT
C
CGCTATGGCCGTGAAGACCTGGATGTGCTGGGCTTGTCCTTCCGCAAAGACCTGTTCATCGCCACCTAC
CAG
GCCTTCCCCCCGGTGCCCAACCCACCCCGGCCCCCCACCCGCCTGCAGGACCGGCTGCTGAGGAAGC
TG
GGCCAGCATGCCCACCCCTTCTTCTTCACCATACCCCAGAATCTTCCATGCTCCGTCACACTGCAGCC
A
GGCCCAGAGGATACAGGAAAGGCCTGCGGCGTAGACTTTGAGATTCGAGCCTTCTGTGCTAAATCACTA
GAA
GAGAAAAGCCACAAAAGGAACTCTGTGCGGCTGGTGATCCGAAAGGTGCAGTTCGCCCCGGAGAAAC
CC
GGCCCCCAGCCTTCAGCCGAAACCACACGCCACTTCCTCATGTCTGACCGGTCCCTGCACCTCGAGGC
T
TCCCTGGACAAGGAGCTGTACTACCATGGGGAGCCCCTCAATGTAAATGTCCACGTCACCAACAACTCC
ACC
AAGACCGTCAAGAAGATCAAAGTCTCTGTGAGACAGTACGCCGACATCTGCCTCTTCAGCACCGCCC
AG
TACAAGTGTCCTGTGGCTCAACTCGAACAAGATGACCAGGTATCTCCCAGCTCCACATTCTGTAAGGT
G
TACACCATAACCCCACTGCTCAGCGACAACCGGGAGAAGCGGGGTCTCGCCCTGGATGGGAAACTCAAG
CAC
GAGGACACCAACCTGGCTTCCAGCACCATCGTGAAGGAGGGTGCCAACAAGGAGGTGCTGGGAATCC
TG
GTGTCCTACAGGGTCAAGGTGAAGCTGGTGGTGTCTCGAGGCGGGGATGTCTCTGTGGAGCTGCCTTT
T
GTTCTTATGCACCCCAAGCCCCACGACCACATCCCCCTCCCCAGACCCCAGTCAGCCGCTCCGGAGACA
GAT
GTCCCTGTGGACACCAACCTCATTGAATTTGATACCAACTATGCCACAGATGATGACATTGTGTTTG
AG
GACTTTGCCCGGCTTCGGCTGAAGGGGATGAAGGATGACGACTATGATGATCAACTCTGCTAG


Translation (394 aa):
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVVFVTLTCAFRYGREDLDVLGLSFRKDLFIATY
Q
AFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFT
IPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSL
E
EKSHK
RNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNS
T
KTVKKIKVS
VRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLK
H
EDTNLASST
IVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPET
D
VPVDTNLIEFDT
NYATDDDIVFEDFARLRLKGMKDDDYDDQLC



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser