NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10506.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10506.2 Public Homo sapiens 16 SLX4 17 106 76 CCDS HistoryNCBI Gene:84464Re-query CCDS DB by CCDS ID:10506.2Re-query CCDS DB by GeneID:84464See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 10506.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000294008 ENSP00000294008 Accepted alive Link to Ensembl Transcript Viewer:ENST00000294008Link to Ensembl Protein Viewer:ENSP00000294008Re-query CCDS DB by Nucleotide ID:ENST00000294008Re-query CCDS DB by Protein ID:ENSP00000294008
Original member Current member EBI,WTSI OTTHUMT00000157301 OTTHUMP00000082733 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000157301Link to Vega Protein Viewer:OTTHUMP00000082733Re-query CCDS DB by Nucleotide ID:OTTHUMT00000157301Re-query CCDS DB by Protein ID:OTTHUMP00000082733
Original member Current member NCBI NM_032444.2 NP_115820.2 Accepted alive Link to Nucleotide Sequence:NM_032444.2Link to Protein Sequence:NP_115820.2Re-query CCDS DB by Nucleotide ID:NM_032444Re-query CCDS DB by Protein ID:NP_115820Link to BLink:NP_115820.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_115820.2 1834 Q8IY92-1 1834 100% 0 0

Chromosomal Locations for CCDS 10506.2

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 3582342 3582693 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3583097 3583510 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3584769 3584871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3589002 3591310 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3592699 3592865 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3594453 3594599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3595605 3595693 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3596153 3596393 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3597379 3597695 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3597797 3597999 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3600979 3601191 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3602118 3602307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3606474 3606698 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 3608430 3608964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5505 nt):
ATGAAACTGAGTGTGAATGAGGCTCAGCTAGGCTTCTACTTGGGTTCACTTTCTCATCTGTCTGCCTGTC
CT
GGGATTGACCCTCGCTCCTCTGAAGACCAGCCTGAAAGCCTTAAAACTGGTCAGATGATGGATGAGTC
T
GATGAGGACTTTAAAGAACTCTGCGCTAGCTTTTTCCAAAGGGTGAAAAAACATGGAATCAAGGAAGTG
TCA
GGAGAAAGGAAGACACAAAAGGCTGCCTCAAACGGCACTCAGATAAGAAGCAAATTGAAAAGGACCA
AA
CAAACTGCTACCAAGACCAAAACCCTTCAAGGCCCTGCAGAGAAGAAACCTCCGTCTGGCAGCCAGGC
C
CCTAGGACTAAAAAGCAAAGGGTAACCAAATGGCAAGCAAGTGAACCGGCCCACTCTGTGAATGGGGAG
GGG
GGTGTGCTTGCCTCTGCTCCAGATCCACCTGTGCTCCGGGAAACAGCACAAAACACCCAGACGGGTA
AC
CAGCAAGAACCATCGCCAAACCTTTCCAGAGAGAAAACCAGAGAGAATGTGCCCAACAGCGACTCCCA
G
CCTCCTCCTTCCTGTTTGACAACAGCAGTGCCAAGTCCCTCCAAACCCCGCACAGCACAATTGGTCCTA
CAG
CGAATGCAGCAGTTCAAGAGAGCAGACCCCGAGCGTTTGAGACACGCTTCAGAAGAGTGCTCCCTCG
AG
GCTGCGCGGGAAGAAAATGTCCCAAAGGATCCTCAAGAGGAGATGATGGCGGGGAATGTGTATGGGCT
T
GGGCCCCCTGCCCCAGAGAGCGACGCTGCGGTGGCCTTGACCCTGCAGCAGGAGTTTGCACGGGTAGGA
GCA
TCGGCACATGATGATAGCCTGGAGGAAAAGGGTTTGTTCTTCTGCCAGATTTGTCAAAAGAACCTCT
CA
GCCATGAACGTGACCCGAAGGGAACAGCATGTGAACAGGTGCTTGGATGAAGCTGAAAAGACACTAAG
A
CCTTCTGTGCCTCAGATCCCTGAGTGCCCGATTTGTGGGAAACCGTTTCTTACCTTAAAGAGCAGAACC
AGT
CACTTGAAGCAGTGTGCTGTGAAGATGGAGGTTGGCCCCCAGCTCCTGCTTCAGGCTGTGCGGCTGC
AG
ACAGCACAGCCTGAGGGTAGCAGCAGCCCACCCATGTTCAGCTTCAGTGATCACAGTAGAGGTCTGAA
A
CGGAGAGGACCCACCAGCAAGAAGGAGCCACGGAAGAGGCGGAAGGTGGACGAGGCACCGTCCGAGGAC
CTG
CTGGTGGCCATGGCTCTGTCCCGGTCGGAGATGGAGCCGGGTGCGGCTGTACCAGCGCTCAGGCTGG
AA
AGTGCCTTTTCTGAGAGGATAAGACCAGAAGCAGAGAATAAAAGTCGCAAGAAGAAACCCCCGGTATC
C
CCCCCATTGTTGTTAGTCCAGGACTCTGAAACCACAGGCCGACAGATAGAGGACCGTGTGGCCCTGCTC
CTC
TCTGAGGAAGTGGAATTGTCTAGCACGCCACCACTTCCTGCCAGCAGGATTTTAAAGGAAGGGTGGG
AA
AGAGCGGGCCAGTGTCCTCCTCCACCTGAACGCAAGCAGAGCTTTCTGTGGGAGGGCAGCGCACTGAC
T
GGGGCCTGGGCCATGGAGGACTTCTACACGGCCAGGCTGGTCCCTCCTCTCGTGCCCCAGCGGCCTGCC
CAG
GGCCTTATGCAGGAGCCCGTGCCGCCTCTGGTGCCACCTGAGCACTCAGAGCTGAGCGAGCGAAGGT
CA
CCCGCTCTCCACGGCACCCCCACTGCAGGCTGTGGCTCCAGGGGCCCGTCGCCTTCGGCCAGCCAGAG
G
GAGCACCAGGCCCTGCAGGACCTCGTGGACCTGGCGAGGGAGGGACTGAGCGCCAGCCCGTGGCCCGGC
AGT
GGGGGCCTGGCTGGCTCGGAAGGGACTGCAGGGTTGGACGTGGTGCCCGGCGGCCTTCCTCTGACTG
GG
TTTGTGGTGCCATCGCAGGACAAGCACCCGGACAGGGGCGGCCGCACCTTGCTCTCCCTCGGGCTGCT
G
GTTGCTGACTTTGGCGCCATGGTCAATAACCCACACCTGAGTGATGTCCAGTTTCAGACGGACAGCGGG
GAG
GTGCTTTACGCCCACAAGTTCGTGCTTTATGCCCGATGCCCGCTCCTCATCCAGTATGTGAACAATG
AA
GGCTTCTCCGCTGTAGAGGACGGGGTTCTGACCCAGCGTGTCCTGCTGGGTGACGTGAGCACCGAGGC
C
GCCCGCACGTTCCTGCACTATCTCTACACTGCGGACACTGGCCTTCCTCCTGGCCTTAGCTCTGAGCTG
AGC
TCCCTGGCCCACAGGTTTGGCGTGAGTGAGCTCGTTCACCTGTGCGAACAGGTGCCTATTGCCACTG
AC
TCAGAGGGCAAACCATGGGAGGAGAAGGAAGCAGAGAATTGCGAAAGCAGGGCCGAGAATTTCCAGGA
A
CTCTTGAGGTCAATGTGGGCAGATGAAGAGGAGGAAGCGGAGACTTTGTTGAAATCCAAGGACCACGAA
GAA
GATCAAGAAAACGTGAATGAAGCAGAAATGGAAGAAATTTATGAATTTGCAGCTACTCAGCGAAAGC
TT
CTCCAGGAAGAAAGGGCAGCGGGTGCCGGCGAGGACGCTGACTGGCTGGAGGGTGGCAGTCCGGTTTC
T
GGGCAACTCCTAGCAGGTGTCCAGGTGCAGAAACAGTGGGACAAGGTGGAGGAGATGGAGCCGTTGGAG
CCA
GGAAGAGATGAGGCCGCCACCACCTGGGAGAAGATGGGACAGTGCGCTCTCCCGCCACCCCAGGGCC
AG
CACTCAGGGGCACGGGGAGCAGAGGCCCCTGAGCAGGAGGCGCCAGAGGAGGCGCTTGGCCATTCCAG
C
TGCTCCAGCCCTTCCAGGGACTGCCAGGCAGAGAGAAAAGAAGGCTCTCTTCCGCACTCAGATGATGCC
GGG
GATTACGAACAGCTCTTCTCATCAACTCAGGGAGAGATCTCAGAGCCGTCCCAAATAACAAGTGAGC
CC
GAGGAACAAAGTGGCGCTGTCAGGGAAAGGGGGCTGGAGGTTTCTCATCGCCTGGCTCCCTGGCAGGC
A
TCTCCACCGCACCCGTGCCGCTTCCTATTGGGGCCTCCCCAGGGCGGGAGTCCCCGCGGGTCTCATCAC
ACA
AGTGGGTCGTCCCTGTCAACACCCCGGTCCCGTGGCGGAACTTCCCAGGTGGGCTCCCCAACCTTGC
TG
TCTCCAGCTGTGCCATCAAAGCAGAAAAGGGACAGGAGCATCCTCACGCTGTCTAAAGAGCCAGGGCA
C
CAGAAAGGCAAAGAGCGTCGGTCCGTGCTGGAGTGCAGAAATAAGGGGGTCCTGATGTTCCCAGAAAAA
TCT
CCGTCTATTGACCTAACCCAGTCAAATCCTGACCATTCGAGCTCCAGATCTCAGAAATCTTCATCCA
AA
CTGAACGAAGAAGATGAGGTCATCCTCTTACTGGACTCGGATGAGGAGCTGGAGCTAGAACAAACCAA
A
ATGAAGTCCATTTCTAGTGATCCTCTGGAAGAAAAGAAAGCTCTAGAAATTAGCCCTAGGTCCTGTGAG
CTG
TTTTCCATCATTGATGTTGATGCAGATCAGGAACCTTCCCAGAGCCCACCAAGAAGCGAAGCTGTGC
TG
CAGCAGGAGGATGAGGGGGCGCTGCCGGAGAATCGGGGCTCTTTGGGCAGGAGAGGGGCTCCCTGGCT
G
TTCTGTGACCGTGAGAGCAGCCCCAGCGAGGCCAGCACCACAGACACCTCGTGGCTGGTGCCCGCCACC
CCG
CTGGCCAGCAGAAGCCGTGACTGTTCTTCCCAGACCCAAATCAGCAGCCTCAGGAGCGGGCTGGCCG
TG
CAGGCGGTGACTCAGCACACGCCCAGGGCCTCAGTAGGAAACAGGGAAGGGAACGAAGTCGCACAGAA
G
TTTTCTGTCATCAGGCCCCAGACACCACCGCCCCAGACACCGTCCTCATGCCTCACTCCCGTCTCTCCA
GGA
ACTTCTGACGGCAGAAGGCAAGGCCACAGAAGCCCTTCCCGTCCCCACCCCGGGGGCCACCCGCACT
CC
TCTCCGCTGGCTCCACATCCCATCTCAGGGGACCGCGCCCACTTCAGCAGGCGGTTCCTGAAACACTC
G
CCGCCTGGGCCAAGCTTCCTGAACCAGACCCCAGCGGGTGAAGTGGTGGAAGTCGGAGACAGTGACGAT
GAG
CAGGAGGTGGCCTCCCATCAGGCCAACAGAAGCCCCCCACTGGACAGTGACCCCCCAATTCCAATTG
AC
GACTGCTGCTGGCACATGGAGCCCCTCTCGCCAATTCCCATTGACCACTGGAACCTGGAGCGGACCGG
C
CCCCTGAGCACCAGCAGCCCCAGCCGCAGGATGAACGAGGCCGCCGACAGCCGTGACTGTCGCTCCCCG
GGA
CTCCTGGACACCACCCCCATCCGAGGAAGCTGCACTACCCAGAGGAAATTGCAAGAGAAGTCCTCGG
GC
GCGGGCTCCCTGGGGAATAGCAGGCCGAGCTTTCTGAATTCGGCTCTGTGGGACGTTTGGGACGGGGA
A
GAGCAGAGGCCTCCAGAGACCCCTCCTCCGGCCCAGATGCCAAGCGCTGGTGGAGCTCAGAAGCCCGAA
GGG
TTAGAGACACCCAAAGGTGCTAATCGGAAGAAGAACTTGCCCCCCAAAGTGCCCATAACGCCGATGC
CA
CAGTATTCCATTATGGAGACGCCGGTGCTGAAGAAGGAACTGGATAGGTTTGGAGTCCGCCCTCTGCC
T
AAACGCCAGATGGTTCTGAAGCTGAAGGAGATATTCCAGTACACTCACCAGACCCTGGACTCAGACTCC
GAG
GACGAGAGCCAGTCCTCACAGCCGCTGTTGCAGGCGCCTCACTGCCAGACCCTCGCCTCCCAGACCT
AC
AAGCCTTCAAGGGCAGGGGTCCATGCCCAGCAGGAGGCCACCACAGGACCTGGGGCCCATAGGCCCAA
G
GGACCTGCTAAGACCAAGGGCCCCCGACATCAAAGGAAGCATCATGAAAGCATCACACCCCCAAGCAGG
TCG
CCCACCAAGGAGGCACCTCCAGGCCTCAATGATGACGCCCAGATCCCAGCCTCTCAAGAATCCGTGG
CC
ACCTCTGTGGATGGCAGTGACAGCTCCTTGAGCTCACAGAGTTCTTCCTCCTGTGAGTTTGGAGCGGC
A
TTTGAGTCTGCAGGTGAAGAGGAGGGCGAGGGGGAGGTCAGTGCCTCGCAGGCAGCCGTGCAGGCGGCG
GAC
ACAGACGAGGCGCTGAGGTGCTACATCCGCTCCAAGCCGGCCCTGTACCAGAAGGTGCTGCTGTACC
AG
CCCTTTGAGCTGCGGGAGCTGCAGGCAGAGCTGAGGCAGAACGGCCTCCGTGTGTCCTCGCGCAGGCT
G
TTGGACTTCCTGGACACCCACTGTATCACCTTCACCACTGCCGCCACCCGCAGGGAGAAGCTCCAGGGC
AGG
AGGCGGCAGCCTCGGGGCAAGAAGAAGGTGGAGCGGAACTGA


Translation (1834 aa):
MKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPESLKTGQMMDESDEDFKELCASFFQRVKKHGIKEV
S
GERKTQKAASNGTQIRSKLKRTKQTATKTKTLQGPAEKKPPSGSQAPRTKKQRVTKWQASEPAHSVNGE
G
GVLASAPDPPVLRETAQNTQTGNQQEPSPNLSREKTR
ENVPNSDSQPPPSCLTTAVPSPSKPRTAQLVL
Q
RMQQFKRADPERLRHASEECSLEAAREENVPKDPQEEMMAGN
VYGLGPPAPESDAAVALTLQQEFARVG
A
SAHDDSLEEKGLFFCQICQKNLSAMNVTRREQHVN
RCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRT
S
HLKQCAVKMEVGPQLLLQAVRLQTAQPEGSSSPPMF
SFSDHSRGLKRRGPTSKKEPRKRRKVDEAPSED
L
LVAMALSRSEMEPGAAVPALRLESAFSERIRPEA
ENKSRKKKPPVSPPLLLVQDSETTGRQIEDRVALL
L
SEEVELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAWAMEDFYTARLVPPLVPQRPA
Q
GLMQEPVPPLVPPEHSELSERRSPALHGTPTAGCGSRGPSPSASQREHQALQDLVDLAREGLSASPWPG
S
GGLAGSEGTA
GLDVVPGGLPLTGFVVPSQDKHPDRGGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSG
E
VLYAHKFVLYARCPLLIQY
VNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSEL
S
SLAH
RFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHE
E
DQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQWDKVEEMEPLE
P
GRDEAATTWEKMGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSSPSRDCQAERKEGSLPHSDDA
G
DYEQLFSSTQGEISEPSQITSEPEEQSGAVRERGLEVSHRLAPWQASPPHPCRFLLGPPQGGSPRGSHH
T
SGSSLSTPRSRGGTSQVGSPTLLSPAVPSKQKRDRSILTLSKEPGHQKGKERRSVLECRNKGVLMFPEK
S
PSIDLTQSNPDHSSSRSQKSSSKLNEEDEVILLLDSDEELELEQTKMKSISSDPLEEKKALEISPRSCE
L
FSIIDVDADQEPSQSPPRSEAVLQQEDEGALPENRGSLGRRGAPWLFCDRESSPSEASTTDTSWLVPAT
P
LASRSRDCSSQTQISSLRSGLAVQAVTQHTPRASVGNREGNEVAQKFSVIRPQTPPPQTPSSCLTPVSP
G
TSDGRRQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPGPSFLNQTPAGEVVEVGDSDD
E
QEVASHQANRSPPLDSDPPIPIDDCCWHMEPLSPIPIDHWNLERTGPLSTSSPSRRMNEAADSRDCRSP
G
LLDTTPIRGSCTTQRKLQEKSSGAGSLGNSRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPE
G
LETP
KGANRKKNLPPKVPITPMPQYSIMETPVLKKELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSDS
E
DESQSSQPLLQAPHCQTLASQTYKPSRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESITPPSR
S
PTKEAPPGLNDDAQIPASQESVATSVDGSDSSLSSQ
SSSSCEFGAAFESAGEEEGEGEVSASQAAVQAA
D
TDEALRCYIRSKPALYQKVLLYQPFELRELQAELRQNGLRVSSRRLLDFLDTHCITFTTAATRREKLQG
R
RRQPRGKKKVERN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser