NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS5126.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5126.1 Public Homo sapiens 6 PKIB 24 110 108 CCDS HistoryNCBI Gene:5570Re-query CCDS DB by CCDS ID:5126.1Re-query CCDS DB by GeneID:5570See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5126.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000354275.2 ENSP00000346227.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000354275.2Link to Ensembl Protein Viewer:ENSP00000346227.2Re-query CCDS DB by Nucleotide ID:ENST00000354275Re-query CCDS DB by Protein ID:ENSP00000346227
Original member Current member EBI ENST00000368448.5 ENSP00000357433.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368448.5Link to Ensembl Protein Viewer:ENSP00000357433.1Re-query CCDS DB by Nucleotide ID:ENST00000368448Re-query CCDS DB by Protein ID:ENSP00000357433
Original member Current member EBI ENST00000368452.7 ENSP00000357437.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000368452.7Link to Ensembl Protein Viewer:ENSP00000357437.2Re-query CCDS DB by Nucleotide ID:ENST00000368452Re-query CCDS DB by Protein ID:ENSP00000357437
Original member Current member EBI ENST00000392490.5 ENSP00000376280.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392490.5Link to Ensembl Protein Viewer:ENSP00000376280.1Re-query CCDS DB by Nucleotide ID:ENST00000392490Re-query CCDS DB by Protein ID:ENSP00000376280
Original member Current member EBI ENST00000392491.6 ENSP00000376281.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392491.6Link to Ensembl Protein Viewer:ENSP00000376281.1Re-query CCDS DB by Nucleotide ID:ENST00000392491Re-query CCDS DB by Protein ID:ENSP00000376281
Original member Current member NCBI NM_001270393.2 NP_001257322.1 Accepted alive Link to Nucleotide Sequence:NM_001270393.2Link to Protein Sequence:NP_001257322.1Re-query CCDS DB by Nucleotide ID:NM_001270393Re-query CCDS DB by Protein ID:NP_001257322Link to BLAST:NP_001257322.1
Original member Current member NCBI NM_032471.6 NP_115860.1 Accepted alive Link to Nucleotide Sequence:NM_032471.6Link to Protein Sequence:NP_115860.1Re-query CCDS DB by Nucleotide ID:NM_032471Re-query CCDS DB by Protein ID:NP_115860Link to BLAST:NP_115860.1
Original member Current member NCBI NM_181794.3 NP_861459.1 Accepted alive Link to Nucleotide Sequence:NM_181794.3Link to Protein Sequence:NP_861459.1Re-query CCDS DB by Nucleotide ID:NM_181794Re-query CCDS DB by Protein ID:NP_861459Link to BLAST:NP_861459.1
Original member Current member NCBI NM_181795.3 NP_861460.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_181795.3Link to Protein Sequence:NP_861460.1Re-query CCDS DB by Nucleotide ID:NM_181795Re-query CCDS DB by Protein ID:NP_861460Link to BLAST:NP_861460.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001257322.1 78 Q9C010-1 78 100% 0 0
NP_115860.1 78 Q9C010-1 78 100% 0 0
NP_861459.1 78 Q9C010-1 78 100% 0 0
NP_861460.1 78 Q9C010-1 78 100% 0 0

Chromosomal Locations for CCDS 5126.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 122717795 122717963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 122725128 122725195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (237 nt):
ATGAGGACAGATTCATCAAAAATGACTGACGTGGAGTCTGGGGTCGCCAATTTTGCATCTTCAGCAAGGG
CAGGCCGCCGGAATGCCTTACCAGACATCCAGAGTTCAGCTGCCACAGACGGAACCTCAGATTTGCCCCT
CAAACTGGAGGCTCTCTCCGTGAAGGAAGATGCAAAAGAGAAAGATGAAAAAACAACACAAGACCAATTG
GAAAAGCCTCAAAATGAAGAAAAATGA

Translation (78 aa):
MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL
EKPQNEEK


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH