NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3903.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3903.1 Public Homo sapiens 5 17 106 76 CCDS HistoryNCBI Gene:23600Re-query CCDS DB by CCDS ID:3903.1Re-query CCDS DB by GeneID:23600See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3903.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000382072 ENSP00000371504 Accepted alive Link to Ensembl Transcript Viewer:ENST00000382072Link to Ensembl Protein Viewer:ENSP00000371504Re-query CCDS DB by Nucleotide ID:ENST00000382072Re-query CCDS DB by Protein ID:ENSP00000371504
Original member Current member EBI,WTSI OTTHUMT00000207468 OTTHUMP00000115917 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000207468Link to Vega Protein Viewer:OTTHUMP00000115917Re-query CCDS DB by Nucleotide ID:OTTHUMT00000207468Re-query CCDS DB by Protein ID:OTTHUMP00000115917
Original member Current member NCBI NM_203382.2 NP_976316.1 Accepted alive Link to Nucleotide Sequence:NM_203382.2Link to Protein Sequence:NP_976316.1Re-query CCDS DB by Nucleotide ID:NM_203382Re-query CCDS DB by Protein ID:NP_976316Link to BLink:NP_976316.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_976316.1 198 Q9UHK6-4 198 100% 0 0

Chromosomal Locations for CCDS 3903.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 33989484 33989502 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 33998641 33998827 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 34005756 34005899 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 34007773 34008019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (597 nt):
ATGGCACTGCAGGGCATCTCGGTCGTGGAGCTGTCCGGCCTGGCCCCGGGCCCGTTCTGTGCTATGGTCC
TG
GCTGACTTCGGGGCGCGTGTGGTACGCGTGGACCGGCCCGGCTCCCGCTACGACGTGAGCCGCTTGGG
C
CGGGGCAAGCGCTCGCTAGTGCTGGACCTGAAGCAGCCGCGGGGAGCCGCCGTGCTGCGGCGTCTGTGC
AAG
CGGTCGGATGTGCTGCTGGAGCCCTTCCGCCGCGGTGTCATGGAGAAACTCCAGCTGGGCCCAGAGA
TT
CTGCAGCGGGAAAATCCAAGGCTTATTTATGCCAGGCTGAGTGGATTTGGCCAGTCAGGAAGCTTCTG
C
CGGTTAGCTGGCCACGATATCAACTATTTGGCTTTGTCAGGTGGAAGGAACAGCATATTTAAGTTCTTT
TCT
GTGGAAAACTCAGAAATTGAGTCTGTGGGAAGCACCTCGAGGACAGAACATGTTGGATGGTGGAGCA
CC
TTTCTATACGACTTACAGGACAGCAGATGGGGAATTCATGGCTGTTGGAGCAATAGAACCCCAGTTCT
A
CGAGCTGCTGATCAAAGGACTTGGACTAAAGTCTGA


Translation (198 aa):
MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLC
K
RSDVLLEPFRR
GVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSIFKFF
S
VENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQ
RTWTKV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser