NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38981.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38981.1 Public Mus musculus 4 Camta1 16 104 75 CCDS HistoryNCBI Gene:100072Re-query CCDS DB by CCDS ID:38981.1Re-query CCDS DB by GeneID:100072

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 38981.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000049790 ENSMUSP00000054804 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000049790Link to Ensembl Protein Viewer:ENSMUSP00000054804Re-query CCDS DB by Nucleotide ID:ENSMUST00000049790Re-query CCDS DB by Protein ID:ENSMUSP00000054804
Original member Current member EBI,WTSI ENSMUST00000169423 ENSMUSP00000127916 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169423Link to Ensembl Protein Viewer:ENSMUSP00000127916Re-query CCDS DB by Nucleotide ID:ENSMUST00000169423Re-query CCDS DB by Protein ID:ENSMUSP00000127916
Original member Current member EBI,WTSI OTTMUST00000024009 OTTMUSP00000011013 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000024009Link to Vega Protein Viewer:OTTMUSP00000011013Re-query CCDS DB by Nucleotide ID:OTTMUST00000024009Re-query CCDS DB by Protein ID:OTTMUSP00000011013
Original member Current member NCBI NM_001081557.3 NP_001075026.1 Accepted alive Link to Nucleotide Sequence:NM_001081557.3Link to Protein Sequence:NP_001075026.1Re-query CCDS DB by Nucleotide ID:NM_001081557Re-query CCDS DB by Protein ID:NP_001075026Link to BLink:NP_001075026.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001075026.1 1682 A2A891-1 1682 100% 0 0

Chromosomal Locations for CCDS 38981.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 151062823 151062855 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151071426 151071456 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151073988 151074062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151075092 151075285 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151076577 151076597 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151077864 151077935 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151078781 151079027 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151079687 151079874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151083677 151084200 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151084563 151084878 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151085560 151085638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151086014 151086210 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151088830 151088981 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151131542 151131676 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151138314 151138440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151143716 151145568 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151148410 151148550 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151163816 151163969 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151290032 151290103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151453284 151453419 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151586415 151586482 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151830418 151830536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151835814 151835883 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 151861625 151861669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5049 nt):
ATGTGGCGCGCGGAGGGGAAATGGCTGCCGAAAACAAGCCGGAAGAGCGTTTCCCAAAGTGTATTCTGCG
GA
ACTAGCACCTACTGTGTTCTCAACACCGTGCCACCTATAGAAGATGATCATGGGAACAGCAATAGTAG
T
CATGTAAAAATCTTTTTACCGAAAAAGCTGCTTGAATGTCTGCCGAAATGTTCAAGTTTACCCAAAGAG
AGG
CACCGCTGGAACACTAATGAGGAAATTGCGGCTTATTTAATAACATTTGAGAAACACGAAGAATGGC
TA
ACCACATCCCCTAAGACAAGACCGCAGAATGGCTCCATGATACTCTACAACAGGAAGAAAGTGAAGTA
C
AGGAAAGACGGGTACTGCTGGAAGAAGAGGAAAGATGGGAAAACGACCAGAGAGGACCACATGAAGCTC
AAA
GTCCAGGGAGTTGAGTGCTTGTACGGCTGCTATGTCCATTCCTCCATCATACCTACTTTCCACCGGA
GG
TGCTACTGGCTCCTTCAGAACCCCGACATCGTCCTGGTGCACTACCTGAATGTGCCGGCCATTGAGGA
C
TGCGGCAAGCCCTGTGGGCCCATCCTCTGCTCCATCAACACCGACAAGAAGGAGTGGGCTAAGTGGACG
AAG
GAGGAACTCATCGGGCAGCTGAAGCCCATGTTCCATGGTATCAAATGGACCTGCAGCAATGGAAACA
GC
AGCTCAGGCTTCTCCGTGGAGCAGCTGGTGCAACAGATCCTCGACAGCCACCAGACCAAGCCCCAGCC
C
CGGACCCACAACTGCCTCTGCACCGGCAGCCTGGGAGCGGGCAGCAGCGTGCATCATAAGTGTAATAGT
GCC
AAACACCGCATCATCTCACCAAAGGTGGAGCCGCGGGCCGGGGGCTATGGGGGCCACTCGGAAGTAC
AA
CACAACGACGTGTCAGAGGGCAAGCATGAACCCAGCCACGGCAGGAGCACGAGCCGGGAGAAGAGGAA
T
GGCAAGGTGGCCAAGCCGGCACTGCTGCACCAGAACAGCACGGAGGTTTCCTCCACCAACCAGGTGGAG
GTC
CCCGACACTACCCAGAGCTCCCCCGTGTCCATCAGCAGCGGGCTCAACAGTGACCCAGACATGGTAG
AC
AGCCCGGTTGTCACAGGTGTGTCCAGCATGGCAGTGGCCTCTGTGATGGGGGGACTGTCCCAAAGTGC
C
ACAGTGTTTATGTCCGAGGTCACTAACGAGGCCGTGTACACCATGTCCCCCACCGCTGGTCCCAACCAC
CAC
CTCCTCTCGCCCGATGCCTCTCAGGGCCTTGTACTGGCTGTAAGTTCTGACGGCCACAAGTTTGCCT
TC
CCCACCACGGGCAGCTCAGACAGCCTGTCCATGCTGCCCGCCAATGTGTCCGAAGAGCTGGTCCTCTC
C
ACCACCCTCGACGGTGGCCGGAAGATTCCAGAGACCGCCATGAACTTCGACCCCGACTGTTTCCTCAAT
AAT
CCAAAGCAGGGCCAGACATACGGGGGTGGGGGCCTGAAAGCTGAGATGGTTAGCACCAATATCCGGC
AC
TCGCCGCCTGCAGAGAGGAGCTTTGGCTTCACCAGCGTCCTCACCAAGGAGATCAAGACCGAAGACAC
C
TCCTTTGAGCAGCAGATGGCCAAAGAGGCGGCCTACTCCTCCTCGGCGGCAGCTGCCGCGTCCAGCTCC
CTC
ACACTGACCGCGGCGGGATCTAGCCTCCTGCCGTCGGGCGGTGGCCTGAGTCCCAGCACCACCCTCG
AG
CAGATGGACTTCAGTGCCATAGACTCTAACAAGGACTACGCGTCCAGCTTCAGCCAGACGGGCCACAG
C
CCCCATATCCACCAAACCCCCTCCCCCAGCTTCTTCCTGCAGGATGCCAGCAAGCCCCTCCCCCTTGAG
CAG
AATACCCACAGCAGCCTAAGCGAGTCAGGGGCCGCCTTTGTGATGCCCACGGTGAAAACGGAGGCCT
CG
TCCCAAACCAGCTCTTGCAGCGGCCACGTGGAAACCCGGATAGAGTCTACTTCCTCCTTGCACCTCAT
G
CAGTTCCAGGCCAACTTCCAAGCCATGGCGGCAGAAGGGGAGGTTACCATGGAGACCTCACAGGCAGCT
GAA
GGGAATGAGGTCCTCCTCAAGTCTGGGGAGCTGCAGGCCTGTGGCTCTGAGCACTACCTGCAGCCAG
AG
ACCAATGGGGTGATCCGCAGCGCAGGTGGCGTCCCCCTTCTCCCGAGCAATGTGGTGCAGGGACTCTA
C
CCGGTGGCCCAGCCCAGCCTGGGCAACAGCTCTAACATGGAGCTCAGCCTGGACCACTTTGACATTTCC
TTC
AGCAATCAGTTCTCAGACCTGATCAATGACTTCATCTCTGTGGAGGGGGGCAGTGGTACGATCTACG
GG
CACCAGCTGGTGTCGGGGGACAGCGCTGCACTCTCACAGTCGGAAGATGGGGCGCGGGCACCCTTCAC
C
CAGGCGGAGATGTGTATTCCCTGCTGCAGCCCCCAACAGGGCAGCCTGCAGCTGAGCAGCGCTGAGGGC
GGG
CCCAGCACCATGGCCTACATGCATGTTGCAGAGGTGGTCTCGGCCGCCTCGGCCCAGGGCGCCCTGG
GC
ATGCTGCAGCAGAGCGGACGGGTGTTCATGGTGACTGACTATTCCCCAGAGTGGTCTTACCCAGAGGG
A
GGAGTGAAGGTTCTCATCACAGGCCCATGGCAAGAAGCCAGCAATAATTACAGTTGCCTGTTTGACCAG
ATC
TCCGTGCCTGCATCCCTGATTCAGCCTGGGGTGTTGCGTTGCTACTGCCCAGCCCACGACACGGGTC
TT
GTGACCCTGCAAGTTGCCTTCAACAATCAGATCATCTCTAATTCGGTGGTGTTTGAGTACAAGGCTCG
G
GCGCTGCCCACACTCCCTTCCTCCCAGCACGACTGGCTGTCACTGGACGATAACCAGTTCAGGATGTCC
ATC
CTGGAGCGTCTGGAGCAGATGGAAAGGAGGATGGCCGAGATGACCGGCTCCCAGCAGCACAAGCAGG
CG
AGCGGCGGAGGCGGCAGCGGGAGCGGCAGCGGGAGTGGTGCCGGAGGGGGCCAGGCCCAGTGTGCCTC
G
GGCGCTGGGACCCTGGGGAGCTGCTTCGAGAGCCGTGTGGTTGTCGTGTGTGAGAAGATGATGAGCCGG
GCC
TGCTGGGCCAAGTCCAAGCATCTGATCCATTCGAAGACCTTCCGCGGGATGACCCTCTTACACCTGG
CT
GCTGCCCAGGGCTACGCCACCCTGATCCAGACCCTCATCAAATGGCGCACAAAGCATGCAGACAGCAT
T
GATTTGGAACTGGAGGTTGATCCCCTGAATGTGGACCACTTCTCCTGTACTCCTCTGATGTGGGCCTGT
GCC
CTGGGGCACTTGGAAGCGGCTGTGGTGCTCTACAAGTGGGACCGCCGGGCCATCTCCATCCCCGACT
CT
CTGGGACGGCTGCCTTTGGGAATTGCCAGGTCGAGGGGCCACGTGAAGTTAGCAGAGTGTCTGGAACA
C
CTGCAGAGAGATGAGCAGGCCCAGTTGGGACAGGCCTCCCGGATCCACTGTGCCCCAAGCGAAGAGCCA
ACC
ACAGACAGCTGGATGGCCCAGTGGCAGAGGGAGGCCATGAGCCCTCCAGAAATACCCAAAGGAGTCA
CT
GTCATTGCGAGCACCAATCCAGAGCTGAGAAGACCTCGGTCTGAACCCTCTAATTACTACAGCACTGA
G
GGCCACAAAGATTATCCGGCTCCCAAAAAGCATAAATTGAACCCCGAGTCCTTCCAGGCAAGGCAGGAG
AAG
CTGCTCTGCACTGCACTGAGTCTGGAGCAGCCAAATATCAGGAAGCAGAGCCCTAGGTCTAAGCAGC
CT
TCCCCCGAGACAATCAGCCCCAGTGAAGGAGTGAGGGAGTACAGCCGGGAAGCCGCCCCTCCCACTCC
A
GAGACTGCAGCATCCCAAGCGTCTGCATCTCAGCCTGTAGTAAAGTGGAGTGCCAAAGATCTTTACATT
GGT
GTGTCTACAGTACAGGTGACTGGAAATCCGAAGGGGACCAGTGTAGTAAAGGACGCGGCGCCTTCAC
AG
GTGCGCCCGAGGGAACCAATGAGCGTCCTGATGTTGGCTAACAGAGAGGTGGTGAATACAGAGATGGG
G
GCCTACCGGGATAGGACAGAGCACGAGGATTGCCCCCAGCCCATGGATGATATTCAGGTGAACATGATG
ACC
TTGGCGGAGCACATTATCGAGGCCACACCAGACCGAATCAAGCAGGAGAACTTTGTGCCCATGGAAT
CC
TCAGCCTTGGAAAGAACAGATCCAGCCACCATTAGCAGTACGATGAGCTGGCTGGCCAGTTACCTAGC
C
GATGCTGACCGTCTGCCCAGTGCTGCCCACATCAGGAGTGCGTACACTGAGCCCCTGACGCCGTCTTCT
AAT
GCCAGCTTGAGTCCCGCAGGCTCTCCAGTCAGTGAGGTGGCTTTCGAGAAACCCAGCCTTCCCTCTG
CG
GCAGACTGGTCAGAATTCCTGAGTGCGTCCACCAGTGAGAAGGTGGAGAGTGAGCTTGCTCAGCTCAC
A
CTGTCCGACCACGAGCAGAGAGAACTCTATGAAGCTGCCAGGCTTGTCCAGACAGCCTTCCGGAAGTAC
AAG
GGCAGACCCCTGCGGGAACAGCAAGAAGTGGCTGCTGCCGTCATCCAGCGCTGTTACAGGAAGTACA
AA
CAGCTGACATGGATAGCCTTGAAGTATGCACTTTACAAAAAGATGACCCAGGCGGCCATCCTTATCCA
G
AGCAAATTCCGAAGTTACTATGAGCAGAAGCGGTTCCAGCAGAGCCGGCGCGCTGCAGTGCTGATCCAG
AAC
TTCTACCGGAGTTACAAGAAGTGTGGCCGGAGACGGCCGGCCCGCAGGACCGCTGTCATCGTGCAGC
AG
AAGCTCAGGAGCAGTTTGCTGACCAAAAAGCAGGACCAAGCTGCTCGAAAGATAATGAGGTTTCTGCG
T
CGCTGTCGCCACAGCCCCCTGGTGGACCATAGGCTGTACAAAAGGAGTGAAAGAATTGAAAAAGGCCAA
GGA
ACTTGA


Translation (1682 aa):
MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPIEDDHGNSNSSHVKIFLPKKLLECLPKCSSLPKE
R
HRWNTNE
EIAAYLITFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKDGYCWKKRKDGKTTREDHMKL
K
VQGVE
CLYGCYVHSSIIPTFHRRCYWLLQNPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWT
K
EELIGQLKPM
FHGIKWTCSNGNSSSGFSVEQLVQQILDSHQTKPQPRTHNCLCTGSLGAGSSVHHKCNS
A
KHRIISPKVEPRAGGYGGHSEVQHNDVSEGKHEPSHGRSTSREKRNGKVAKPALLHQNSTEVSSTNQVE
V
PDTTQSSPVSISSGLNSDPDMVDSPVVTGVSSMAVASVMGGLSQSATVFMSEVTNEAVYTMSPTAGPNH
H
LLSPDASQGLVLAVSSDGHKFAFPTTGSSDSLSMLPANVSEELVLSTTLDGGRKIPETAMNFDPDCFLN
N
PKQGQTYGGGGLKAEMVSTNIRHSPPAERSFGFTSVLTKEIKTEDTSFEQQMAKEAAYSSSAAAAASSS
L
TLTAAGSSLLPSGGGLSPSTTLEQMDFSAIDSNKDYASSFSQTGHSPHIHQTPSPSFFLQDASKPLPLE
Q
NTHSSLSESGAAFVMPTVKTEASSQTSSCSGHVETRIESTSSLHLMQFQANFQAMAAEGEVTMETSQAA
E
GNEVLLKSGELQACGSEHYLQPETNGVIRSAGGVPLLPSNVVQGLYPVAQPSLGNSSNMELSLDHFDIS
F
SNQFSDLINDFISVEGGSGTIYGHQLVSGDSAALSQSEDGARAPFTQAEMCIPCCSPQQGSLQLSSAEG
G
PSTMAYMHVAEVVSAASAQGALGMLQQSGRVFMVTDYSPEWSYPE
GGVKVLITGPWQEASNNYSCLFDQ
I
SVPASLIQPGVLRCYCP
AHDTGLVTLQVAFNNQIISNSVVFEYKARALPTLPSSQHDWLSLDDNQFRMS
I
LERLEQMERRMAEMTGSQQHKQASGGGGSGSGSGSGAGGGQAQ
CASGAGTLGSCFESRVVVVCEKMMSR
A
CWAKSKHLIHSKTFRGMTLLHLAAAQGYATLIQTLIKW
RTKHADSIDLELEVDPLNVDHFSCTPLMWAC
A
LGHLEAAVVLYKWDRRAISIPDSLGRLPLGIARSRGHVKLAECLEHLQRDEQAQLGQASRIHCAPSEEP
T
TDSWMAQWQREAMSPPEIPKGVTVIASTNP
ELRRPRSEPSNYYSTEGHKDYPAPKKHKLNPESFQARQE
K
LLCTALSLEQPNIRKQSPRSKQPSPETISPSEGVREYSREAAPPTPETAASQASASQPVVKWSAKDLYI
G
VSTVQVTGNPKGTSVVKDAAPSQVRPREPMSVLMLANREVVNTEMGAYRDRTEHEDCPQPMDDIQ
VNMM
T
LAEHIIEATPDRIKQENFVPMESSALERTDPATISSTMSWLASYLADADRLPSAAHI
RSAYTEPLTPSS
N
ASLSPAGSPVSEVAFEKPSLPSAADWSEFLSASTSEKVESELAQLTLSDHEQRELYEAARLVQTAFRKY
K
GRPLREQQEVAAAVIQRCYRKYKQLTWIALKYALYKKMTQAAILIQSKFRSYYEQKRFQQSRRAAVLIQ
N
FYRSYKKCGRRRPARRTAVIVQQKL
RSSLLTKKQDQAARKIMRFLRRCRHSPLVDHRLYKRSERIEKGQ
G
T




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser