NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37075.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37075.1 Public Mus musculus 15 Taf2 16 104 75 CCDS HistoryNCBI Gene:319944Re-query CCDS DB by CCDS ID:37075.1Re-query CCDS DB by GeneID:319944

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 37075.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041733 ENSMUSP00000043733 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041733Link to Ensembl Protein Viewer:ENSMUSP00000043733Re-query CCDS DB by Nucleotide ID:ENSMUST00000041733Re-query CCDS DB by Protein ID:ENSMUSP00000043733
Original member Current member NCBI NM_001081288.1 NP_001074757.1 Accepted alive Link to Nucleotide Sequence:NM_001081288.1Link to Protein Sequence:NP_001074757.1Re-query CCDS DB by Nucleotide ID:NM_001081288Re-query CCDS DB by Protein ID:NP_001074757Link to BLink:NP_001074757.1

Chromosomal Locations for CCDS 37075.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

Chromosome Start Stop Links
15 55016342 55016601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55022202 55022324 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55027172 55027277 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55028318 55028547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55031046 55031155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55034163 55034232 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55036518 55036657 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55038239 55038432 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55040363 55040473 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55043109 55043249 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55045736 55045988 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55047418 55047483 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55048226 55048335 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55048627 55048741 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55049395 55049549 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55052116 55052251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55054234 55054319 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55055787 55055886 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55058799 55058912 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55059903 55060087 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55062053 55062284 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55062993 55063134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55064588 55064706 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55065860 55066020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55071393 55071447 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 55071847 55071929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3597 nt):
ATGCCGCCCACCGGCTTAGAGTCCTCCAGGATGAACAGGAAGAAAGGAGACAAGGGCTTCGAAAGCCCAC
GG
CCGTACAAATTAACCCATCAGGTCGTCTGTATCAACAACATAAACTTCCAGCGAAAATCAGTTGTGGG
A
TTTGTGGAGCTGACTATATTTCCCACAGTTGCCAACTTGAATAGAATTAAGTTGAACAGTAAACAGTGT
AGA
ATATACCGAGTCCGGATCAATGACTTGGAGGCCGCTTTTATTTATAATGATCCAACCTTAGAAGTTT
GT
CACAGTGAATCGAAACAGAGAAACCTCAATTATTTTTCCAATGCGTATGCAGCTGCAGTCAGTGCTGT
G
GACCCTGATGCGGGGAATGGAGAACTCTGCATTAAGGTTCCCTCAGAGCTCTGGAAACATGTCGATGAG
TTG
AAGGTCCTGAAGATACATATTAATTTTTCTTTGGATCAACCAAAAGGAGGTCTTCATTTTGTGGTAC
CC
AGTGTAGAGGGGAGTATGGCAGAGAGAGGTGCTCATGTCTTCTCTTGCGGGTATCAAAATTCTACAAG
A
TTTTGGTTCCCGTGTGTCGATTCATACTCTGAGCTGTGTACCTGGAAGTTAGAATTTACAGTAGATGCT
GCA
ATGGTAGCCGTGTCCAATGGAGATTTGGTGGAGACCGTGTATACCCATGACATGAGGAAGAAGACCT
TC
CATTATATGCTTACTATTCCTACTGCAGCATCCAATATCTCCTTGGCCATTGGACCATTTGAAATACT
C
GTGGATCCATACATGCATGAGGTTACCCATTTTTGTTTGCCTCAACTTCTTCCGTTACTTAAACATACT
ACG
TCATACATTCACGAAGTTTTTGAATTTTATGAAGAAATTTTGACTTGTCGCTATCCGTACTCCTGTT
TT
AAGACGGTCTTCATTGATGAGGCATATGTTGAAGTGGCCGCTTACGCTTCTATGAGCATTTTCAGCAC
A
AACCTTCTGCACAGCGCCATGATTATAGACGAGACGCCGCTGACCAGACGGTGCTTGGCACAGGCTTTA
GCA
CAGCAGTTCTTCGGATGTTTCATATCCAGGATGTCTTGGTCTGATGAATGGGTGCTGAAGGGAATTT
CA
GGCTATATTTATGGACTGTGGATGAAAAAAACATTCGGAGTCAATGAGTACCACCATTGGATTAAAGA
G
GAGCTAGATAAAATAGTGGCGTATGAACTGAAAACTGGGGGAGTTTTGCTTCATCCCATATTTGGTGGT
GGA
AAAGAAAAGGATAACCCCGCATCTCACCTCCACTTTTCCATAAAGCATCCACATACACTGTCCTGGG
AG
TACTACACTATGTTCCAGTGTAAAGCTCACCTCGTGATGAGACTGATTGAAAACAGAATCAGCATGGA
A
TTTATGCTGCAAGTTTTCAATAAACTACTAAGTCTGGCCAGCACTGCTTCGTCTCAGAAGTTCCAGTCA
CAT
ATGTGGAGCCAGATGCTGGTTTCCACTTACGGGTTTTTGAAGTCCATTTCCAATGTCTCTGGCAAAG
AC
ATCCAGCCCCTAATAAAGCAGTGGGTAGACCAGAGTGGAGTGGTAAAGTTTTACGGAAGTTTTGCGTT
T
AATAGAAAACGAAATGTTTTAGAACTAGAAATAAAGCAAGATTACACATCTCCTGGCACCCAGAAGTAC
GTG
GGACCTCTTAAAGTGACAGTGCAAGAGTTAGATGGATCCTTCAACCATACCTTGCAAATTGAAGAAA
AC
AGCCTTAAACATGACATACCCTGCCACTCCAAGAGCAGAAGGAATAAGAAGAAAAAAATCCCACTGAT
G
AATGGGGAAGAAGTTGATATGGATCTTTCTGCAATGGATGCTGATTCCCCTTTGTTGTGGATAAGGATA
GAC
CCAGATATGTCCGTCCTGAGGAAGGTGGAGTTTGAGCAGGCTGATTTTATGTGGCAGTATGAGCTCC
GC
TATGAGAGAGATGTTGTTGCTCAGCAGGAATCCATCTTGGCCTTGGAAAAATTCCCCACTCCGGCATC
G
CGCCTTGCGCTCACTGATATACTAGAGCAAGAGCAGTGTTTCTACCGAGTCAGGATGTCAGCGTGCTTC
TGT
CTTGCAAAGATTGCCAACTCAATGGTGAGCACGTGGACAGGGCCGCCAGCCATGAAGTCTCTCTTTA
CT
AGAATGTTCTGCTGTAAAACCTGCCCCAACATTGTGAAGACAAACAACTTCATGAGTTTCCAAAGCTA
C
TTTCTGCAGAAGACTATGCCGGTTGCAATGGCTTTGTTAAGAGATGTACATAACCTTTGTCCTAAAGAA
GTT
TTAACATTTATTTTAGACTTAATCAAGTACAATGACAACAGAAAAAATAAGTTTTCAGATAACTATT
AT
CGTGCAGAAATGATTGATGCCCTTGCTAACTCAGTTACACCTGCTGTCAGTGTGAATAATGAAGTCAG
A
ACTTTGGATAACTTAAATCCTGATGTGCGACTAATTCTTGAAGAAATAACCCGGTTTCTGAATATGGAA
AAG
CTTCTCCCAAGTTACAGACACACCATCACTGTCAGTTGCTTGAGAGCCATCCGGGTGCTTCAGAAGA
AC
GGGCACGTGCCGAGTGATGCATCTCTCTTCAAATCCTACGCCGAGTATGGCCACTTTGTGGACATCAG
G
ATAGCAGCTCTGGAAGCCGTCGTTGATTACACTAAAGTGGACAGGAGTTATGAAGAACTTCAGTGGCTA
CTT
AATATGATTCAGACTGACCCTGTTCCCTATGTGAGGCATAAGATTCTAAACATGCTGACTAAAAATC
CA
CCATTTACAAAGAACATGGAATCTCCTTTATGCAACGAAGCCCTGGTAGATCAGCTCTGGAAGCTGAT
G
AATTCTGGCACTGCACATGACTGGAGGTTACGGTGTGGTGCTGTGGACTTGTACTTCACGCTGTTTGGC
CTC
AGCAGACCGTCTTGCTTACCCTTGCCAGAGCTCGGGCTTGTTCTTAACCTAAAAGAGAAGAAAGCTG
TC
TTGAATCCTACCATTATTCCAGAAGCTGGAGTAGGCAACCAGGAGTCTGCGAGTAACCCAGGCTGCCA
C
GCTCAGCTAGCTGGATTCCAGAACCCTTTTTCAAGTTCTCAGGATGAGGAGGAGGTTGACATGGATACT
GTT
CATGACAGTCAAGCCTTCATCTCCCATCATCTGAACATGCTCGAAAGGCCGTCCACTCCAGGGCTCT
CT
AAGTACCGGCCGTCCGGCTCCAGATCCTCCTTAATGCCCCAGCATTCATTAGGCTGTGACATCACACC
A
CCCACAAAACCCCAGTGGAGTATGGAGCTGTCCCGAAAGGGAGCAGGTAAAGAGCAGCCTTTGGAGATG
GGT
GTGCATTCCATGGTGGCAGCCCCGCTCTCCATGTTTGCTAAGGAGGCTCTGTCATCGCGACACAGCG
AG
CACCATCACCACCATCACCATGAGCACAAGAAGAAGAAGAAGAAGCACAAGCACAAACACAAGCACAA
G
CACAAGCACGACAGCAAGGACAAGGACAGGGAGCCCTTCGCCTTCTCCAGCCCTGCCAGCGGCAGGTCT
GTG
CGCTCCCCCTCACTCTCAGACTGA


Translation (1198 aa):
MPPTGLESSRMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQC
R
IYRVRINDLEAAFIYNDPTLEVCHSESK
QRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDE
L
KVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNST
RFWFPCVDSYSELCTWKLEFTVDA
A
MVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHE
VTHFCLPQLLPLLKHT
T
SYIHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIF
STNLLHSAMIIDETPLTRRCLAQAL
A
QQFFGCFISRMS
WSDEWVLKGISGYIYGLWMKKTFGVNEYHHWIKEELDKIVAYELKTGGVLLHPIFGG
G
KEKD
NPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQS
H
MWSQMLVSTYGFLKSISNVSGKDIQPLIKQW
VDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKY
V
GPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRI
D
PDMSVLRKVEFEQADFMWQYELRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACF
C
LAK
IANSMVSTWTGPPAMKSLFTRMFCCKTCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKE
V
LTFILDLIKYNDNRKNK
FSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNME
K
LLPSYRHTITV
SCLRAIRVLQKNGHVPSDASLFKSYAEYGHFVDIRIAALEAVVDYTKVDRSYEELQWL
L
NMIQTDPVPYV
RHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSGTAHDWRLRCGAVDLYFTLFG
L
SRPSCLPLPELGLVLNLKEKKAVLNPTIIPEAGVGNQESASNPGCHAQLAGFQNP
FSSSQDEEEVDMDT
V
HDSQAFISHHLNMLERPSTP
GLSKYRPSGSRSSLMPQHSLGCDITPPTKPQWSMELSRKGAGKEQPLEM
G
VHSMVAAPLSMFAKEALSSRHSEHHHHHHHEHKKKKKKHKHKHKHKHKHDSKDKDREPFAFSSPASGRS
V
RSPSLSD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser