NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36965.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36965.1 Public Mus musculus 14 Adam28 16 104 75 CCDS HistoryNCBI Gene:13522Re-query CCDS DB by CCDS ID:36965.1Re-query CCDS DB by GeneID:13522See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 36965.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022642 ENSMUSP00000022642 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022642Link to Ensembl Protein Viewer:ENSMUSP00000022642Re-query CCDS DB by Nucleotide ID:ENSMUST00000022642Re-query CCDS DB by Protein ID:ENSMUSP00000022642
Original member Current member NCBI NM_010082.2 NP_034212.1 Accepted alive Link to Nucleotide Sequence:NM_010082.2Link to Protein Sequence:NP_034212.1Re-query CCDS DB by Nucleotide ID:NM_010082Re-query CCDS DB by Protein ID:NP_034212Link to BLink:NP_034212.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034212.1 793 Q9JLN6-1 793 100% 0 0

Chromosomal Locations for CCDS 36965.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 68607455 68607533 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68607917 68607963 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68609107 68609175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68609858 68609936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68610898 68611006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68617692 68617770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68618095 68618175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68619717 68619876 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68622084 68622186 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68626777 68626972 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68629029 68629118 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68630605 68630782 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68633111 68633241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68634811 68634895 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68637331 68637500 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68638062 68638133 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68639146 68639217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68642016 68642208 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68644257 68644333 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68646836 68646914 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68647667 68647743 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68649408 68649511 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 68655639 68655690 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2382 nt):
ATGCAGCAATGGAGTCTTCTGGTAGTCTCTTTCCTTCTTTCTCCAGTTCCAGTAAGTGCAATAAAAGAAC
TC
CCTAAAGCCAAGAAATATGAAGTGGTTTATCCCATAAGACTTCATCCATTGCGTAAAAGAGAGACCCA
A
GAGCCAGAGCCAAAGGAAACATTTGAAACTGAGCTAAGGTACAAAATGACAGTAAATGGAAAGGTTGCT
GTG
CTGTATCTGAAGAAGAACAACAAGCTCCTTGCGCCTGACTACTCGGAAACATACTATAATTCCAGTG
GA
AACAAGGTCACCACAAGCCCGCAAATCATGGATAGCTGTTACTACCAAGGACACATCGTAAATGAGAA
A
GTTTCTGCAGCCAGCATCAGCACCTGTCAAGGACTACGGGGTTACATCAGTCAAGGAGATGAAAAGTAT
TTT
ATCGAACCTTTGAGCTCGGAGAACTTGGATGAACAGGCACATGCACTCTTCAAGGACGACTCCAATG
AA
GACCAGGAGAAGAGCAACTGTGGTGTGGATGATGCGCTATGGCTCCAAGGGCTGCATCAGGACGTGGC
C
CTCCCTGCCACCAGGTTGATTAAGTTGAATGATGGGATGGTTCAAGAACCTAAGAAATACATAGAATAT
TAT
GTGGTCCTGGATAATGGTGAGTTTAAGAAATACAATAAAAATCTTGCTGAAATACGAAAGATAGTGC
TT
GAGATGGCCAATTACATCAACATGCTTTACAATAAGCTTGATGCCCACGTGGCCTTAGTTGGAGTGGA
A
ATCTGGACCGATGGGGATAAAATAAAGATAACACCAGATGCCAACACCACCCTGGAAAACTTCTCTAAG
TGG
AGGGGAAATGATCTGCTAAAACGAAAGCATCATGATATTGCCCAGCTAATCTCATCAACAGACTTTT
CT
GGATCAACAGTGGGTCTAGCCTTCATGTCGTCGATGTGTTCACCTTACCATTCTGTTGGCATTGTTCA
G
GACCACAGTAACTACCATCTTCGAGTCGCAGGAACAATGGCTCATGAAATGGGTCACAATCTTGGCATG
ATT
CATGACTACTTGAGCTGCAAGTGTCCATCTGAAGTCTGTGTAATGGAGCAGTCACTAAGGTTCCATA
TG
CCTACAGACTTCAGCTCCTGCAGTCGTGTCAATTACAAACAGTTTCTTGAAGAAAAATTATCGCATTG
C
CTCTTTAATAGCCCATTGCCATCAGATATCATATCCACCCCAGTCTGTGGGAACCAGTTGTTGGAAATG
AAT
GAGGACTGTGACTGTGGCACACCCAAGGAGTGTACTAACAAATGCTGTGATGCAAGGACCTGTAAAA
TT
AAAGCAGGTTTCCAGTGTGCCCTGGGGGAATGCTGTGAGAAATGCCAACTTAAAAAACCTGGGGTTGT
G
TGCAGAGCAGCAAAAGATGAGTGTGATCTGCCTGAAGTGTGTGATGGTAAATCCAGCCACTGCCCAGGT
GAC
AGATTCAGAGTCAATGGCTCCCCTTGCCAAAATGGGCATGGTTACTGCTTGAAGGGCAAATGTCCCA
CC
CTGCAGCAGCAGTGCATGGACATGTGGGGTCCAGGAACCAAGGTTGCAAATACATCATGTTACAAGCA
G
AATGAAGGTGGGACAAAGTACGGATACTGTCATGTGGAGAATGGCACACACATGCCCTGCAAAGCAAAA
GAT
GCCATGTGTGGGAAATTGTTCTGTGAAGGCGGATCAGGTGATTTGCCCTGGAAAGGACTTACCATAT
CT
TTCCTGACATGTAAATTATTTGATCCTGAAGACACAAGTCAAGGAGTAGACATGGTGGCCAATGGAAC
C
AAGTGTGGAACTAACAAGGTGTGCATTAATGCTGAGTGTGTGGACATGGAGAAGACTTACAAGTCAGCC
AAC
TGCTCCTCAAAGTGCAAGGGGCACGCAGTGTGTGACCATGAGCTTCAGTGTCAGTGCAAGGAAGGAT
GG
GCCCCTCCTGACTGCGAGAATTCAGCCACAGTCTTCCACTTCTCCATCGTGGTTGGCGTGCTTTTCCC
C
CTAGCAGTCATATTTGTGGTGGTTGCTATAGTGATCCAGCGCCAAAGTGCCAGAAGGAAGCAGAGGAGA
GTT
CAGAGGCTACCATCCACCAAGGATGCCAAGCTACACAATCAGAAGTGTAGACCCCAAAAGGTGAAGG
AT
GTTCAACCCCAGGAGATGAGTCAGATGAAAAAGCTCCATGTGTCTGATCTGCCCTCTGAAGAGCCGGA
G
CCTCCACCTGATGTCCTAATCACAAAGCCAAATTTCCCACCACCACCAATTCCTGTTTCCTTGACAGGA
AGA
GCCAAAGTTCCTTTTGTCAAGACACCTCATCCTTTTAGTCAGCAAATAGGCCGCGTGTACCTGAAGT
AA


Translation (793 aa):
MQQWSLLVVSFLLSPVPVSAIKELPKAKKYEVVYPIRLHPLRKRETQEPEPKETFETELRYKMTVNGKVA
V
LYLKKN
NKLLAPDYSETYYNSSGNKVTTSPQIMDSCYYQGHIVNEKVSAASISTCQGLRGYISQGDEKY
F
IEPLSSENLDEQAHALFKDDSNEDQEKSNCGVDDALWLQGLHQDVALPATRLI
KLNDGMVQEPKKYIEY
Y
VVLDNGE
FKKYNKNLAEIRKIVLEMANYINMLYNKLDAHVALVGVEIWTDGDKIKITPDANTTLENFSK
W
RGNDLLKRKHHDIAQLI
SSTDFSGSTVGLAFMSSMCSPYHSVGIVQDHSNYHLRVAGTMAHEMGHNLGM
I
HDYLSCKCPSEVCVMEQSL
RFHMPTDFSSCSRVNYKQFLEEKLSHCLFNSPLPSDIISTPVCGNQLLEM
N
EDCDCGTPK
ECTNKCCDARTCKIKAGFQCALGECCEKCQLKKPGVVCRAAKDECDLPEVCDGKSSHCPG
D
RFRVNGSPCQNGHGYCLKGKCPTLQQQCMDMWGP
GTKVANTSCYKQNEGGTKYGYCHVENGTHMPCKAK
D
AMCGKLFCEGGSGDLPWKGLTISFLTCKLFDPEDTSQGVDMVANGTKCGTNK
VCINAECVDMEKTYKSA
N
CSSKCKGHA
VCDHELQCQCKEGWAPPDCENSATVFHFSIVVGVLFPLAVIFVVVAIVIQRQSARRKQRR
V
Q
RLPSTKDAKLHNQKCRPQKVKDVQPQEMSQMKKLHVSDLPSEEPEPPPDVLITKPNFPPPPIPVSLTG
R
AKVPFVKTPHPFSQQIGRVYLK




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser