NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS3386.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3386.1 Public Homo sapiens 4 17 106 76 CCDS HistoryNCBI Gene:7466Re-query CCDS DB by CCDS ID:3386.1Re-query CCDS DB by GeneID:7466See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 3386.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000226760 ENSP00000226760 Accepted alive Link to Ensembl Transcript Viewer:ENST00000226760Link to Ensembl Protein Viewer:ENSP00000226760Re-query CCDS DB by Nucleotide ID:ENST00000226760Re-query CCDS DB by Protein ID:ENSP00000226760
Original member Current member EBI,WTSI ENST00000503569 ENSP00000423337 Accepted alive Link to Ensembl Transcript Viewer:ENST00000503569Link to Ensembl Protein Viewer:ENSP00000423337Re-query CCDS DB by Nucleotide ID:ENST00000503569Re-query CCDS DB by Protein ID:ENSP00000423337
Original member Current member EBI,WTSI OTTHUMT00000206863 OTTHUMP00000115499 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000206863Link to Vega Protein Viewer:OTTHUMP00000115499Re-query CCDS DB by Nucleotide ID:OTTHUMT00000206863Re-query CCDS DB by Protein ID:OTTHUMP00000115499
Original member Current member EBI,WTSI OTTHUMT00000358733 OTTHUMP00000217278 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000358733Link to Vega Protein Viewer:OTTHUMP00000217278Re-query CCDS DB by Nucleotide ID:OTTHUMT00000358733Re-query CCDS DB by Protein ID:OTTHUMP00000217278
Original member Current member NCBI NM_001145853.1 NP_001139325.1 Accepted alive Link to Nucleotide Sequence:NM_001145853.1Link to Protein Sequence:NP_001139325.1Re-query CCDS DB by Nucleotide ID:NM_001145853Re-query CCDS DB by Protein ID:NP_001139325Link to BLink:NP_001139325.1
Original member Current member NCBI NM_006005.3 NP_005996.2 Accepted alive Link to Nucleotide Sequence:NM_006005.3Link to Protein Sequence:NP_005996.2Re-query CCDS DB by Nucleotide ID:NM_006005Re-query CCDS DB by Protein ID:NP_005996Link to BLink:NP_005996.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001139325.1 890 O76024 890 100% 0 0
NP_005996.2 890 O76024 890 100% 0 0

Chromosomal Locations for CCDS 3386.1

Assembly GRCh38 (GCF_000001405.26)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 6277456 6277687 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 6287093 6287175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 6288987 6289131 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 6291197 6291367 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 6291917 6291997 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 6295041 6295189 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 6300657 6302468 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2673 nt):
ATGGACTCCAACACTGCTCCGCTGGGCCCCTCCTGCCCACAGCCCCCGCCAGCACCGCAGCCCCAGGCGC
GT
TCCCGACTCAATGCCACAGCCTCGTTGGAGCAGGAGAGGAGCGAAAGGCCCCGAGCACCCGGACCCCA
G
GCTGGCCCTGGCCCTGGTGTTAGAGACGCAGCGGCCCCCGCTGAACCCCAGGCCCAGCATACCAGGAGC
CGG
GAAAGAGCAGACGGCACCGGGCCTACAAAGGGAGACATGGAAATCCCCTTTGAAGAAGTCCTGGAGA
GG
GCCAAGGCCGGGGACCCCAAGGCACAGACTGAGGTGGGGAAGCACTACCTGCAGTTGGCCGGCGACAC
G
GATGAAGAACTCAACAGCTGCACCGCTGTGGACTGGCTGGTCCTCGCCGCGAAGCAGGGCCGTCGCGAG
GCT
GTGAAGCTGCTTCGCCGGTGCTTGGCGGACAGAAGAGGCATCACGTCCGAGAACGAACGGGAGGTGA
GG
CAGCTCTCCTCCGAGACCGACCTGGAGAGGGCCGTGCGCAAGGCAGCCCTGGTCATGTACTGGAAGCT
C
AACCCCAAGAAGAAGAAGCAGGTGGCCGTGGCGGAGCTGCTGGAGAATGTCGGCCAGGTCAACGAGCAC
G
AT
GGAGGGGCGCAGCCAGGCCCCGTGCCCAAGTCCCTGCAGAAGCAGAGGCGCATGCTGGAGCGCCTGG
TC
AGCAGCGAGTCCAAGAACTACATCGCGCTGGATGACTTTGTGGAGATCACTAAGAAGTACGCCAAGGG
C
GTCATCCCCAGCAGCCTGTTCCTGCAGGACGACGAAGATGATGACGAGCTGGCGGGGAAGAGCCCTGAG
GAC
CTGCCACTGCGTCTGAAGGTGGTCAAGTACCCCCTGCACGCCATCATGGAGATCAAGGAGTACCTGA
TT
GACATGGCCTCCAGGGCAGGCATGCACTGGCTGTCCACCATCATCCCCACGCACCACATCAACGCGCT
C
ATCTTCTTCTTCATCGTCAGCAACCTCACCATCGACTTCTTCGCCTTCTTCATCCCGCTGGTCATCTTC
TAC
CTGTCCTTCATCTCCATGGTGATCTGCACCCTCAAGGTGTTCCAGGACAGCAAGGCCTGGGAGAACT
TC
CGCACCCTCACCGACCTGCTGCTGCGCTTCGAGCCCAACCTGGATGTGGAGCAGGCCGAGGTCAACTT
C
GGCTGGAACCACCTGGAGCCCTATGCCCATTTCCTGCTCTCTGTCTTCTTCGTCATCTTCTCCTTCCCC
ATC
GCCAGCAAGGACTGCATCCCCTGCTCGGAGCTGGCTGTCATCACCGGCTTCTTTACCGTGACCAGCT
AC
CTGAGCCTGAGCACCCATGCAGAGCCCTACACGCGCAGGGCCCTGGCCACCGAGGTCACCGCCGGCCT
G
CTATCGCTGCTGCCCTCCATGCCCTTGAATTGGCCCTACCTGAAGGTCCTTGGCCAGACCTTCATCACC
GTG
CCTGTCGGCCACCTGGTCGTCCTCAACGTCAGCGTCCCGTGCCTGCTCTATGTCTACCTGCTCTATC
TC
TTCTTCCGCATGGCACAGCTGAGGAATTTCAAGGGCACCTACTGCTACCTTGTGCCCTACCTGGTGTG
C
TTCATGTGGTGTGAGCTCTCCGTGGTCATCCTGCTGGAGTCCACCGGCCTGGGGCTGCTCCGCGCCTCC
ATC
GGCTACTTCCTCTTCCTCTTTGCCCTCCCCATCCTGGTGGCCGGCCTGGCCCTGGTGGGCGTGCTGC
AG
TTCGCCCGGTGGTTCACGTCTCTGGAGCTCACCAAGATCGCAGTCACCGTGGCGGTCTGTAGTGTGCC
C
CTGCTGTTGCGCTGGTGGACCAAGGCCAGCTTCTCTGTGGTGGGGATGGTGAAGTCCCTGACGCGGAGC
TCC
ATGGTCAAGCTCATCCTGGTGTGGCTCACGGCCATCGTGCTGTTCTGCTGGTTCTATGTGTACCGCT
CA
GAGGGCATGAAGGTCTACAACTCCACACTGACCTGGCAGCAGTATGGTGCGCTGTGCGGGCCACGCGC
C
TGGAAGGAGACCAACATGGCGCGCACCCAGATCCTCTGCAGCCACCTGGAGGGCCACAGGGTCACGTGG
ACC
GGCCGCTTCAAGTACGTCCGCGTGACTGACATCGACAACAGCGCCGAGTCTGCCATCAACATGCTCC
CG
TTCTTCATCGGCGACTGGATGCGCTGCCTCTACGGCGAGGCCTACCCTGCCTGCAGCCCTGGCAACAC
C
TCCACGGCCGAGGAGGAGCTCTGTCGCCTTAAGCTGCTGGCCAAGCACCCCTGCCACATCAAGAAGTTC
GAC
CGCTACAAGTTTGAGATTACCGTGGGCATGCCATTCAGCAGCGGCGCTGACGGCTCGCGCAGCCGCG
AG
GAGGACGACGTCACCAAGGACATCGTGCTGCGGGCCAGCAGCGAGTTCAAGAGCGTGCTGCTCAGCCT
G
CGCCAGGGCAGCCTCATCGAGTTCAGCACCATCCTGGAGGGCCGCCTGGGCAGCAAGTGGCCTGTCTTC
GAG
CTCAAGGCCATCAGCTGCCTCAACTGCATGGCCCAGCTCTCACCCACCAGGCGGCACGTGAAGATCG
AG
CACGACTGGCGCAGCACCGTGCATGGCGCCGTGAAGTTCGCCTTCGACTTCTTTTTCTTCCCATTCCT
G
TCGGCGGCCTGA


Translation (890 aa):
MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRS
R
ERADGT
GPTKGDMEIPFEEVLERAKAGDPKAQTEVGKHYLQLAGDTDEELNSCTAVDWLVLAAKQGRRE
A
VKLLRRCLADRR
GITSENEREVRQLSSETDLERAVRKAALVMYWKLNPKKKKQVAVAELLENVGQVNEH
D
GGAQPGPVPKSLQKQRRMLERLVSSESKNYIALDDFVEITKKYAKGVIPSSLFLQDDEDDDELAGKSPE
D
LPLRLK
VVKYPLHAIMEIKEYLIDMASRAGMHWLSTIIPTHHINALIFFFIVSNLTIDFFAFFIPLVIF
Y
LSFISMVICTLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWNHLEPYAHFLLSVFFVIFSFP
I
ASKDCIPCSELAVITGFFTVTSYLSLSTHAEPYTRRALATEVTAGLLSLLPSMPLNWPYLKVLGQTFIT
V
PVGHLVVLNVSVPCLLYVYLLYLFFRMAQLRNFKGTYCYLVPYLVCFMWCELSVVILLESTGLGLLRAS
I
GYFLFLFALPILVAGLALVGVLQFARWFTSLELTKIAVTVAVCSVPLLLRWWTKASFSVVGMVKSLTRS
S
MVKLILVWLTAIVLFCWFYVYRSEGMKVYNSTLTWQQYGALCGPRAWKETNMARTQILCSHLEGHRVTW
T
GRFKYVRVTDIDNSAESAINMLPFFIGDWMRCLYGEAYPACSPGNTSTAEEELCRLKLLAKHPCHIKKF
D
RYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVF
E
LKAISCLNCMAQLSPTRRHVKIEHDWRSTVHGAVKFAFDFFFFPFLSAA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser