NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS32406.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32406.1 Public Homo sapiens 16 PALB2 17 106 76 CCDS HistoryNCBI Gene:79728Re-query CCDS DB by CCDS ID:32406.1Re-query CCDS DB by GeneID:79728See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Sequence IDs included in CCDS 32406.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000261584 ENSP00000261584 Accepted alive Link to Ensembl Transcript Viewer:ENST00000261584Link to Ensembl Protein Viewer:ENSP00000261584Re-query CCDS DB by Nucleotide ID:ENST00000261584Re-query CCDS DB by Protein ID:ENSP00000261584
Original member Current member EBI,WTSI OTTHUMT00000435287 OTTHUMP00000255811 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000435287Link to Vega Protein Viewer:OTTHUMP00000255811Re-query CCDS DB by Nucleotide ID:OTTHUMT00000435287Re-query CCDS DB by Protein ID:OTTHUMP00000255811
Original member Current member NCBI NM_024675.3 NP_078951.2 Accepted alive Link to Nucleotide Sequence:NM_024675.3Link to Protein Sequence:NP_078951.2Re-query CCDS DB by Nucleotide ID:NM_024675Re-query CCDS DB by Protein ID:NP_078951Link to BLink:NP_078951.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_078951.2 1186 Q86YC2 1186 100% 0 0

Chromosomal Locations for CCDS 32406.1

Assembly GRCh38 (GCF_000001405.26)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 23603459 23603669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23607864 23608012 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23614004 23614091 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23621362 23621478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23622969 23623130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23624009 23624094 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23626236 23626397 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23629204 23629275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23629640 23630469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23634862 23636334 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23637850 23637952 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23638070 23638129 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 23641110 23641157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3561 nt):
ATGGACGAGCCTCCCGGGAAGCCCCTCAGCTGTGAGGAGAAGGAAAAGTTAAAGGAGAAATTAGCATTCT
TG
AAAAGGGAATACAGCAAGACACTAGCCCGCCTTCAGCGTGCCCAAAGAGCTGAAAAGATTAAGCATTC
T
ATTAAGAAAACAGTAGAAGAACAAGATTGTTTGTCTCAGCAGGATCTCTCACCGCAGCTAAAACACTCA
G
AA
CCTAAAAATAAAATATGTGTTTATGACAAGTTACACATCAAAACCCATCTTGATGAAGAAACTGGAG
AA
AAGACATCTATCACACTTGATGTTGGGCCTGAGTCCTTTAACCCTGGAGATGGCCCAGGAGGATTACC
T
ATACAAAGAACAGATGACACCCAAGAACATTTTCCCCACAGGGTCAGTGACCCTAGTGGTGAGCAAAAG
CAG
AAGCTGCCAAGCAGAAGAAAGAAGCAGCAGAAGAGGACATTTATTTCACAGGAGAGAGACTGTGTCT
TT
GGCACTGATTCACTCAGATTGTCTGGGAAAAGACTAAAGGAACAGGAAGAAATCAGTAGCAAAAATCC
T
GCTAGATCACCAGTAACTGAAATAAGAACTCACCTTTTAAGTCTTAAATCTGAACTTCCAGATTCTCCA
GAA
CCAGTTACAGAAATTAATGAAGACAGTGTATTAATTCCACCAACTGCCCAACCAGAAAAAGGTGTTG
AT
ACATTCCTAAGAAGACCTAATTTCACCAGGGCGACTACAGTTCCTTTACAGACTCTATCAGATAGCGG
T
AGTAGTCAGCACCTTGAACACATTCCTCCTAAAGGTAGCAGTGAACTTACTACTCACGACCTAAAAAAC
ATT
AGATTTACTTCACCTGTAAGTTTGGAGGCACAAGGCAAAAAAATGACTGTCTCTACAGATAACCTCC
TT
GTAAATAAAGCTATAAGTAAAAGTGGCCAACTGCCCACAAGTTCTAATTTAGAGGCAAATATTTCATG
T
TCTCTAAATGAACTCACCTACAATAACTTACCAGCAAATGAAAACCAAAACTTAAAAGAACAAAATCAA
ACA
GAGAAATCTTTAAAATCTCCCAGTGACACTCTTGATGGCAGGAATGAAAATCTTCAGGAAAGTGAGA
TT
CTAAGTCAACCTAAGAGTCTTAGCCTGGAAGCAACCTCTCCTCTTTCTGCAGAAAAACATTCTTGCAC
A
GTGCCTGAAGGCCTTCTGTTTCCTGCAGAATATTATGTTAGAACAACACGAAGCATGTCCAATTGCCAG
AGG
AAAGTAGCCGTGGAGGCTGTCATTCAGAGTCATTTGGATGTCAAGAAAAAAGGGTTTAAAAATAAAA
AT
AAGGATGCAAGTAAAAATTTAAACCTTTCCAATGAGGAAACTGACCAAAGTGAAATTAGGATGTCTGG
C
ACATGCACAGGACAACCAAGTTCAAGAACCTCTCAGAAACTTCTCTCATTAACTAAAGTCAGCTCTCCC
GCT
GGGCCCACTGAAGATAATGACTTGTCTAGGAAGGCAGTTGCCCAAGCACCTGGTAGAAGATACACAG
GA
AAAAGAAAATCAGCCTGCACCCCAGCATCAGATCATTGTGAACCACTTTTGCCAACTTCTAGCCTGTC
G
ATTGTTAACAGGTCCAAGGAAGAAGTCACCTCACACAAATATCAGCACGAAAAATTATTTATTCAAGTG
AAA
GGGAAGAAAAGTCGTCATCAAAAAGAGGATTCCCTTTCTTGGAGTAATAGTGCTTATTTATCCTTGG
AT
GATGATGCTTTCACGGCTCCATTTCATAGGGATGGAATGCTGAGTTTAAAGCAACTACTGTCTTTTCT
C
AGTATCACAGACTTTCAGTTACCTGATGAAGACTTTGGACCTCTTAAGCTTGAAAAAGTGAAGTCCTGC
TCA
GAAAAACCAGTGGAGCCCTTTGAGTCAAAAATGTTTGGAGAGAGACATCTTAAAGAGGGAAGCTGTA
TT
TTTCCAGAGGAACTGAGTCCTAAACGCATGGATACAGAAATGGAGGACTTAGAAGAGGACCTTATTGT
T
CTACCAGGAAAATCACATCCCAAAAGGCCAAACTCGCAAAGCCAGCATACAAAGACGGGCCTTTCTTCA
TCC
ATATTACTTTATACTCCTTTAAATACGGTTGCGCCTGATGATAATGACAGGCCTACCACAGACATGT
GT
TCACCTGCTTTCCCCATCTTAGGTACTACTCCAGCCTTTGGCCCTCAAGGCTCCTATGAAAAAGCATC
T
ACAGAAGTTGCTGGACGAACTTGCTGCACACCCCAACTTGCTCATTTGAAAGACTCAGTCTGTCTTGCC
AGT
GATACTAAACAATTCGACAGTTCAGGCAGCCCAGCAAAACCACATACCACCCTGCAAGTGTCAGGCA
GG
CAAGGACAACCTACCTGTGACTGTGACTCTGTCCCGCCAGGAACACCTCCACCCATTGAGTCATTCAC
T
TTTAAAGAAAATCAGCTCTGTAGAAACACATGCCAGGAGCTGCATAAACATTCCGTCGAACAGACTGAA
ACA
GCAGAGCTTCCTGCTTCTGATAGCATAAACCCAGGCAACCTACAATTGGTTTCAGAGTTAAAGAATC
CT
TCAGGTTCCTGTTCCGTAGATGTGAGTGCCATGTTTTGGGAAAGAGCCGGTTGTAAAGAGCCATGTAT
C
ATAACTGCTTGCGAAGATGTAGTTTCTCTTTGGAAAGCTCTGGATGCTTGGCAGTGGGAAAAACTTTAT
ACC
TGGCACTTCGCAGAGGTTCCAGTATTACAGATAGTTCCAGTGCCTGATGTGTATAATCTCGTGTGTG
TA
GCTTTGGGAAATTTGGAAATCAGAGAGATCAGGGCATTGTTTTGTTCCTCTGATGATGAAAGTGAAAA
G
CAAGTACTACTGAAGTCTGGAAATATAAAAGCTGTGCTTGGCCTGACAAAGAGGAGGCTAGTTAGTAGC
AGT
GGGACCCTTTCTGATCAACAAGTAGAAGTCATGACGTTTGCAGAAGATGGAGGAGGCAAAGAAAACC
AA
TTTTTGATGCCCCCTGAGGAGACTATACTAACTTTTGCTGAGGTCCAAGGGATGCAAGAAGCTCTGCT
T
GGTACTACTATTATGAACAACATTGTTATTTGGAATTTAAAAACTGGTCAACTCCTGAAAAAGATGCAC
ATT
GATGATTCTTACCAAGCTTCAGTCTGTCACAAAGCCTATTCTGAAATGGGGCTTCTCTTTATTGTCC
TG
AGTCATCCCTGTGCCAAAGAGAGTGAGTCGTTGCGAAGCCCTGTGTTTCAGCTCATTGTGATTAACCC
T
AAGACGACTCTCAGCGTGGGTGTGATGCTGTACTGTCTTCCTCCAGGGCAGGCTGGCAGGTTCCTGGAA
GGT
GACGTGAAAGATCACTGTGCAGCAGCAATCTTGACTTCTGGAACAATTGCCATTTGGGACTTACTTC
TC
GGTCAGTGTACTGCCCTCCTCCCACCTGTCTCTGACCAACATTGGTCTTTTGTGAAATGGTCGGGTAC
A
GACTCTCATTTGCTGGCTGGACAAAAAGATGGAAATATATTTGTATACCACTATTCATAA


Translation (1186 aa):
MDEPPGKPLSCEEKEKLKEKLAFLKREYSKTLARLQRAQRAEKIKHSIKKTVEEQDCLSQQDLSPQLKHS
E
PKNKICVYDKLHIKTHLDEETGEKTSITLDVGPESFNPGDGPGGLPIQRTDDTQEHFPHRVSDPSGEQK
Q
KLPSRRKKQQKRTFISQERDCVFGTDSLRLSGKRLKEQEEISSKNPARSPVTEIRTHLLSLKSELPDSP
E
PVTEINEDSVLIPPTAQPEKGVDTFLRRPNFTRATTVPLQTLSDSGSSQHLEHIPPKGSSELTTHDLKN
I
RFTSPVSLEAQGKKMTVSTDNLLVNKAISKSGQLPTSSNLEANISCSLNELTYNNLPANENQNLKEQNQ
T
EKSLKSPSDTLDGRNENLQESEILSQPKSLSLEATSPLSAEKHSCTVPEGLLFPAEYYVRTTRSMSNCQ
R
KVAVEAVIQSHLDVKKKGFKNKNKDASKNLNLSNEETDQSEIRMSGTCTGQPSSRTSQKLLSLTKVSSP
A
GPTEDNDLSRKAVAQAPGRRYTGKRKSACTPASDHCEPLLPTSSLSIVNRSKEEVTSHKYQHEKLFIQV
K
GKKSRHQKEDSLSWSNSAYLSLDDDAFTAPFHRDGMLSLKQLLSFLSITDFQLPDEDFGPLKLEKVKSC
S
EKPVEPFESKMFGERHLKEGSCIFPEELSPKRMDTEMEDLEEDLIVLPGKSHPKRPNSQSQHTKTGLSS
S
ILLYTPLNTVAPDDNDRPTTDMCSPAFPILGTTPAFGPQGSYEKASTEVAGRTCCTPQLAHLKDSVCLA
S
DTKQFDSSGSPAKPHTTLQVSGRQGQPTCDCDSVPPGTPPPIESFTFKENQLCRNTCQELHKHSVEQ
TE
T
AELPASDSINPGNLQLVSELK
NPSGSCSVDVSAMFWERAGCKEPCIITACEDVVSLWKALDAWQWEKLY
T
WHFAE
VPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSSDDESEKQVLLKSGNIKAVLGLTKRRLVSS
S
GTLSDQQVEVMTFAEDG
GGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMH
I
DDSYQASVCHKAYSEM
GLLFIVLSHPCAKESESLRSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLE
G
DVKDHCAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser