NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30519.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30519.2 Public Mus musculus X Bmx 16 104 75 CCDS HistoryNCBI Gene:12169Re-query CCDS DB by CCDS ID:30519.2Re-query CCDS DB by GeneID:12169

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Public Note for CCDS 30519.1
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript and protein data.

Sequence IDs included in CCDS 30519.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000112265 ENSMUSP00000107884 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112265Link to Ensembl Protein Viewer:ENSMUSP00000107884Re-query CCDS DB by Nucleotide ID:ENSMUST00000112265Re-query CCDS DB by Protein ID:ENSMUSP00000107884
Original member Current member EBI,WTSI OTTMUST00000046571 OTTMUSP00000021030 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046571Link to Vega Protein Viewer:OTTMUSP00000021030Re-query CCDS DB by Nucleotide ID:OTTMUST00000046571Re-query CCDS DB by Protein ID:OTTMUSP00000021030
Original member Current member NCBI NM_009759.4 NP_033889.2 Accepted alive Link to Nucleotide Sequence:NM_009759.4Link to Protein Sequence:NP_033889.2Re-query CCDS DB by Nucleotide ID:NM_009759Re-query CCDS DB by Protein ID:NP_033889Link to BLink:NP_033889.2

Chromosomal Locations for CCDS 30519.2

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

Chromosome Start Stop Links
X 164193736 164193810 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164196895 164197052 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164200774 164200892 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164203190 164203254 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164205168 164205384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164208007 164208178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164208865 164208939 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164213482 164213609 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164218330 164218409 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164220373 164220427 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164231202 164231255 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164232195 164232266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164234902 164235077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164239363 164239427 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164240929 164241048 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164246136 164246217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164248083 164248187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164249013 164249159 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 164258048 164258050 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1968 nt):
ATGGACGACAATATGGAGAGTAAATCCATTCTGGAAGAACTGCTTCTCAAAAAGTCACAGCAAAAGAAGA
AA
ATGTCACCAAATAATTACAAGGAGCGGCTTTTTGTTCTAACCAAAACAAGCCTTTCCTACTATGAATA
C
GACAAAATGAAAAGAGGAAGCAGAAAAGGATCAATAGAAATTAAGAAAATCAGATGTGTGGAAAAAGTC
AAC
CTTGAGGAGCAGACACCGGTGGAGAGACAGTACCCATTTCAGATTGTGTATAAAGATGGGCTTCTTT
AT
GTCTATGCATCGAATGAAGAGAGCCGATGTCAGTGGTTAAAAGCGCTGCAAAAAGAGATACGGGGCAA
C
CCTCACCTGTTGATCAAGTATCACAGTGGCTTCTTTGTGGATGGAAAGTTCCTGTGTTGCCAGCAGAGC
TGC
AAAGCAGCCCCAGGATGCACTCTCTGGGAAGCATATGCTGATCTGCACATCGCAATCAGTGATGAGA
AA
CACAGAGCTCCCACTTTCCCAGAGAGGCTACTGAAGATTCCAAGGGCAGTTCCCGTTCTCAAAATGGA
T
GCATCATCTTCAGGTGCCATTCTACCCCAATATGACAGCTATTCAAAGAAAAGTTGTGGTTCCCAGCCA
ACC
AGCAACATACGCTATATTCCAAGGGAAGACTGCCCTGACTGGTGGCAAGTAAGAAAACTGAAAAGCG
AG
GAAGACATTGCATGCAGTAACCAACTGGAAAGAAATATCGCCTCTCACAGCACCTCAAAGATGTCATG
G
GGATTCCCTGAGTCAAGTTCATCAGAAGAAGAGGAAAATCTGCATGCTTATGACTGGTTTGCTGGGAAT
ATC
TCCAGGTCACAATCTGAGCAGTTACTGAGACAAAAGGGAAAAGAAGGAGCATTTATGGTTCGGAATT
CC
AGCCAGATGGGAATGTACACTGTGTCCTTATTTAGTAAGGCTGTAAATGATAAAAAAGGAACTGTCAA
G
CATTACCACGTGCATACTAATGCTGAAAATAAATTATACCTGGCTGAAAACTACTGCTTTGATTCCATT
CCA
AAGCTCATTCACTATCACCAACATAATTCAGCAGGCATGATCACACGGCTCCGCCACCCAGTGTCAA
CC
AAGGCCAACAAGGTCCCGGTGTCTGTGGCTCTGGGAAGTGGAATTTGGGAACTGAAAAGAGAAGAGAT
T
ACCTTGCTGAAGGAGCTGGGCAATGGCCAGTTTGGAGTGGTCCAGCTGGGCCAGTGGAAGGGGCAATAT
GAT
GTGGCTGTAAAGATGATCAAGGAGGGTGCCATGTCAGAAGATGAATTCTTTCAGGAGGCCCAGACCA
TG
ATGAAACTCAGCCATCCCAAGCTGGTGAAGTTCTACGGAGTATGCTCAAAGAAATACCCCATCTATAT
A
GTAACTGAGTATATAACAAATGGTTGCTTGCTTAATTACCTGAAGAGTCATGGGAAAGGACTAGAAAGT
TGC
CAGCTCTTAGAAATGTGTTATGATGTCTGTGAAGGCATGGCCTTCTTGGAGAGCCATCAGTTCATAC
AT
CGAGATTTGGCTGCTCGGAACTGTTTGGTGGACAGTGATCTCTCTGTGAAAGTCTCAGACTTTGGAAT
G
ACGAGATATGTCCTTGATGATCAGTATGTCAGCTCAGTAGGAACCAAGTTTCCAGTCAAGTGGTCAGCT
CCA
GAGGTGTTTCACTACTTCAAATACAGCAGCAAGTCGGATGTATGGGCATTTGGGATCCTGATGTGGG
AG
GTGTTTAGTCTAGGGAAGCAGCCCTATGACTTATATGATAACTCCGAGGTGGTTGTGAAGGTCTCCCA
G
GGCCACAGACTCTACCGGCCCCAACTGGCATCAGACACCATCTACCAGATCATGTACAGCTGCTGGCAT
GAG
CTTCCAGAAAAGCGCCCCACATTTCAGCAACTCCTGTCTGCCATAGAACCACTTCGGGAACAAGATA
AA
CCATGA


Translation (655 aa):
MDDNMESKSILEELLLKKSQQKKKMSPNNYKERLFVLTKTSLSYYEYDKMKRGSRKGSIEIKKIRCVEKV
N
LEEQTPVERQYPFQ
IVYKDGLLYVYASNEESRCQWLKALQKEIRGNPHLLIKYHSGFFVDGKFLCCQQS
C
KAAPGCTLWEA
YADLHIAISDEKHRAPTFPERLLKIPRAVPVLKMDASSSGAILPQYDSYSKKSCGSQP
T
SNIRYIPREDCPDWWQVRKLK
SEEDIACSNQLERNIASHSTSKMSWGFPESSSSEEEENLHAYDWFAGN
I
SRSQSEQLLRQK
GKEGAFMVRNSSQMGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLYLAENYCFDSI
P
KLIHYHQHNSA
GMITRLRHPVSTKANKVPVSVALGSGIWELKREEITLLKELGNGQFGVVQLGQWKGQY
D
VAVKMIKEGAMSEDEFFQEAQTM
MKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNYLKSHGKGLES
C
QLLEMCYDVCEGMAFLESHQFIHRDL
AARNCLVDSDLSVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSA
P
EVFHYFKYSSKSDVWAF
GILMWEVFSLGKQPYDLYDNSEVVVKVSQGHRLYRPQLASDTIYQIMYSCWH
E
LPEKRPTFQQLLSAIEPLREQDKP



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser