NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28170.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28170.1 Public Mus musculus 16 Poglut1 16 104 75 CCDS HistoryNCBI Gene:224143Re-query CCDS DB by CCDS ID:28170.1Re-query CCDS DB by GeneID:224143

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28170.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000036210 ENSMUSP00000038166 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000036210Link to Ensembl Protein Viewer:ENSMUSP00000038166Re-query CCDS DB by Nucleotide ID:ENSMUST00000036210Re-query CCDS DB by Protein ID:ENSMUSP00000038166
Original member Current member EBI,WTSI OTTMUST00000069719 OTTMUSP00000035454 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000069719Link to Vega Protein Viewer:OTTMUSP00000035454Re-query CCDS DB by Nucleotide ID:OTTMUST00000069719Re-query CCDS DB by Protein ID:OTTMUSP00000035454
Original member NCBI NM_172380.3 NP_759012.1 Updated not alive Link to Nucleotide Sequence:NM_172380.3Link to Protein Sequence:NP_759012.1Re-query CCDS DB by Nucleotide ID:NM_172380Re-query CCDS DB by Protein ID:NP_759012
Current member NCBI NM_172380.4 NP_759012.1 Accepted alive Link to Nucleotide Sequence:NM_172380.4Link to Protein Sequence:NP_759012.1Re-query CCDS DB by Nucleotide ID:NM_172380Re-query CCDS DB by Protein ID:NP_759012Link to BLink:NP_759012.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_759012.1 392 Q8BYB9 392 100% 0 0

Chromosomal Locations for CCDS 28170.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

Chromosome Start Stop Links
16 38526625 38526781 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38527577 38527633 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38529445 38529612 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38531784 38531842 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38534725 38534824 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38537907 38537966 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38542838 38542959 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38545749 38545884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38548438 38548581 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38549343 38549433 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 38550083 38550167 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1179 nt):
ATGGAGCGTCGGGCGGGCTCTCGGCTTAGGGCATGGATGCTGTTACTGCTCCTGTGCCCGGTGCAGGGCC
GC
CAGAAGGACTCAGGCTCAAAATGGAAAGTATTTCTTGACCAAATTAACAGGGCTTTGGAGAATTATGA
A
CCATGTTCAAGTCAAAACTGCAGCTGCTATCACGGCGTCATAGAAGAGGACCTGACTCCTTTCCGAGGT
GGG
ATCTCCAGGAAGATGATGGCTGAGGTGGTCAGGCGGAAGCTAGGAACCCACTACCAGATCATTAAGA
AC
CGGTTATTCAGGGAAGATGACTGCATGTTTCCCTCCAGGTGTAGTGGCGTGGAACACTTTATTTTGGA
A
GTCATCCATCGCCTCCCTGACATGGAAATGGTAATCAATGTCCGAGATTATCCTCAGGTTCCTAAATGG
ATG
GAGCCTACCATCCCCGTCTTCTCCTTCAGTAAGACATCGGAGTACCATGATATCATGTATCCTGCGT
GG
ACATTTTGGGAAGGGGGCCCTGCTGTGTGGCCACTTTATCCTACAGGTCTTGGACGGTGGGACCTCTT
C
AGAGAAGACCTGTTAAGGTCAGCAGCGCAATGGCCGTGGGAAAAGAAAAATTCTACAGCATATTTCCGA
GGA
TCAAGGACAAGCCCAGAAAGAGATCCTCTCATTCTCCTATCTCGGAAAAATCCAAAGCTCGTCGATG
CC
GAGTACACCAAAAACCAGGCCTGGAAGTCTATGAAAGATACTCTGGGAAAGCCAGCCGCTAAGGATGT
A
CACCTCATAGATCACTGCAAATACAGATACCTATTTAATTTTCGAGGTGTAGCTGCAAGCTTCCGGTTC
AAA
CACCTCTTCTTGTGCGGTTCACTGGTCTTCCATGTTGGTGATGAGTGGGTGGAGTTCTTCTACCCAC
AA
CTAAAGCCATGGGTTCACTACATCCCAGTCAAGACCGACCTCTCCAATGTCCAGGAGCTGTTGCAGTT
T
GTAAAAGCGAATGATGATATCGCTCAGGAAATTGCTAAAAGGGGAAGCCAGTTCATCATAAACCATTTG
CAG
ATGGATGACATCACCTGTTACTGGGAGAACCTCTTGACTGACTATTCCAAATTCCTGTCCTATAATG
TA
ACAAGAAGAAAAGATTATTATCAGATCGTTCCCAGACGTTTGAAAACTGAACTGTAG


Translation (392 aa):
MERRAGSRLRAWMLLLLLCPVQGRQKDSGSKWKVFLDQINRALENYEPCSSQNCSCYHGVIEEDLTPFRG
G
ISRKMMAEVVRRKLGTHYQIIKNRLFREDDCMFPS
RCSGVEHFILEVIHRLPDMEMVINVRDYPQVPKW
M
EPTIPVFSFSK
TSEYHDIMYPAWTFWEGGPAVWPLYPTGLGRWDLFREDLLRSAAQWPWEKKNSTAYFR
G
S
RTSPERDPLILLSRKNPKLVDAEYTKNQAWKSMKDTLGKPAAKDVHLIDHCKYRYLFNFRGVAASFRF
K
HLFLCGSLVFHVGDEWVEFFYPQLKPWVHYIPVKTDLSNV
QELLQFVKANDDIAQEIAKRGSQFIINHL
Q
MDDITCYWENLLTDYSKFLSYNVTRRKDYYQIVPRRLKTEL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser