NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28018.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28018.1 Public Mus musculus 16 Dgcr8 16 104 75 CCDS HistoryNCBI Gene:94223Re-query CCDS DB by CCDS ID:28018.1Re-query CCDS DB by GeneID:94223

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28018.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000009321 ENSMUSP00000009321 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000009321Link to Ensembl Protein Viewer:ENSMUSP00000009321Re-query CCDS DB by Nucleotide ID:ENSMUST00000009321Re-query CCDS DB by Protein ID:ENSMUSP00000009321
Original member Current member EBI,WTSI ENSMUST00000115633 ENSMUSP00000111296 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115633Link to Ensembl Protein Viewer:ENSMUSP00000111296Re-query CCDS DB by Nucleotide ID:ENSMUST00000115633Re-query CCDS DB by Protein ID:ENSMUSP00000111296
Original member Current member EBI,WTSI OTTMUST00000057892 OTTMUSP00000027994 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000057892Link to Vega Protein Viewer:OTTMUSP00000027994Re-query CCDS DB by Nucleotide ID:OTTMUST00000057892Re-query CCDS DB by Protein ID:OTTMUSP00000027994
Original member Current member EBI,WTSI OTTMUST00000057893 OTTMUSP00000027995 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000057893Link to Vega Protein Viewer:OTTMUSP00000027995Re-query CCDS DB by Nucleotide ID:OTTMUST00000057893Re-query CCDS DB by Protein ID:OTTMUSP00000027995
Original member Current member NCBI NM_033324.2 NP_201581.2 Accepted alive Link to Nucleotide Sequence:NM_033324.2Link to Protein Sequence:NP_201581.2Re-query CCDS DB by Nucleotide ID:NM_033324Re-query CCDS DB by Protein ID:NP_201581Link to BLink:NP_201581.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_201581.2 773 Q9EQM6 773 100% 0 0

Chromosomal Locations for CCDS 28018.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

Chromosome Start Stop Links
16 18255522 18255605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18256672 18256785 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18258194 18258321 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18259549 18259655 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18259879 18259979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18272721 18272803 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18277166 18277264 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18278039 18278140 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18278319 18278516 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18280220 18280502 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18280614 18280756 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18283124 18283283 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 18283697 18284416 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2322 nt):
ATGGAGACATATGAGAGTCCCTCTCCTCTCCCGCGTGAGCCCGCAGGAGAAGCGATGATGGAGAACCGAG
CT
TGCCCCTTCCAAGTGCTGCCCCATGAACAGTCTCCACCACCTCCCCTGCAAACGTCCAGTGATGCAGA
G
GTAATGGACGTTGGCTCTGGTGGTGATGGACAGTCCGAACCTCCTGCCGACGACCCATTCAACTTCTAC
GGA
GCTTCTCTTCTCTCCAAAGGATCCTTCTCTAAGGGCCGCCTCCTCATAGACCCGAACTGTAGTGGCC
AC
AGCCCGCGCACTGCCCGGCACGCACCTGCGGTCCGGAAGTTCTCCCCTGACCTTAAGTTGCTTAAGGA
T
GTAAAGATTAGCGTGAGCTTTACTGAGAGCTGCAGGAGTAAGGACAGGAAGGTGCTGTACACAGGAGTA
GAA
CGCAGCACTCGGCCTGAGTGTGGCCAGCTCCTTAGTCCTGTCAGTGGGGACGTGCATGCTTGTCCCT
TT
GGCGGGAGTGTTGGTAATGGGGTAGGCCTAGGGGGTGAGAGTGCAGATAAGAAGGATGAGGAAAATGA
G
CTGGATCAGGAAAAGAGAGTGGAGTATGCAGTGCTCGATGAGTTAGAAGATTTTACTGACAATTTGGAG
CTA
GATGAAGAAGGAACAGGCGGGTTCACGGCTAAAGCAATCGTTCAAAGAGACAGAGTGGATGAAGAGG
CC
TTGAATTTCTCCTATGAGGATGACTTTGACAATGATGTGGACGCTTTACTAGAAGAAGGTCTCTGTGC
T
CCCAAGAAGAGGCGAATGGAGGAAAAATATGGCGGAGACAGTGATCATCCATCTGATGGAGAGACAAGT
GTA
CAGCCAATGATGACCAAGATTAAAACAGTGCTCAAAAGTCGTGGCCGTCCACCTACAGAGCCATTGC
CT
GATGGATGGATCATGACTTTTCATAATTCTGGAGTCCCTGTATACCTGCACAGAGAGTCTCGAGTGGT
C
ACTTGGTCCAGACCCTACTTCTTGGGAACAGGAAGCATACGGAAACATGATCCTCCTCTAAGCAGTATC
CCC
TGCCTACATTATAAGAAAATGAAGGACAATGAGGAACGAGAACAAAACTGTGATCTTGCCCCCAGTG
GA
GAGGTGTCACCTGTCAAGCCCTTGGGTCGGTCTGCAGAGTTGGATTTCCCTCTGGAAGAGCCTGACTC
C
ATGGGTGGAGACTCAGGGTCCATGGATGAGAAGGACCCATTGGGGGCTGAGGCAGCCGCTGGAGCCCTG
GGA
CAAGTGAAGGCTAAAGTTGAGGTGTGCAAAGATGAATCAGTTGATCTGGAGGAATTTCGTAATTACC
TT
GAGAAGCGTTTTGACTTTGAACAAGTAACTGTGAAAAAATTCAGGACTTGGGCTGAGCGGCGTCAGTT
C
AACCGTGAGATGAAGCGGAAGCAGGCCGAGTCAGAGAGGCCCATCCTGCCAGCCAACCAGAAGCTGATC
ACT
CTATCTGTACAAGATGCACCCACAAAGAAAGAGTTTGTCATCAATCCCAATGGGAAGTCTGAGGTTT
GC
ATCCTGCACGAATACATGCAGCGTGTCCTCAAGGTCCGCCCTGTTTATAATTTCTTTGAATGTGAGAA
T
CCAAGTGAGCCTTTTGGTGCCTCCGTGACCATTGATGGTGTGACTTACGGATCTGGAACTGCAAGCAGC
AAA
AAACTTGCGAAGAATAAAGCTGCCCGAGCCACCCTGGAAATTCTCATCCCTGACTTTGTTAAACAGA
CC
TCTGAGGAGAAGCCTAAAGACAGTGAAGAACTGGAGTATTTTAACCACATCAGTATTGAGGATTCACG
A
GTCTATGAGCTGACAAGCAAGGCTGGGCTGTTGTCTCCATATCAGATCCTCCATGAGTGCCTTAAAAGA
AAC
CATGGAATGGGTGACACATCCATCAAGTTTGAAGTGGTTCCTGGGAAAAACCAGAAGAGTGAATATG
TT
ATGGCATGCGGCAAACACACAGTGCGCGGGTGGTGTAAGAATAAACGAGTTGGGAAACAATTAGCATC
T
CAGAAAATCCTTCAGCTACTGCACCCACATGTCAAGAACTGGGGTTCCTTACTACGCATGTATGGTCGT
GAG
AGCAGCAAAATGGTCAAGCAGGAGACCTCTGACAAGAGTGTGATAGAGCTACAGCAGTATGCCAAGA
AG
AACAGGCCCAACCTTCACATCCTGAGCAAGCTACAAGAAGAGATGAAGAGGCTGGCTGCAGAGCGGGA
G
GAGACTCGGAAGAAACCCAAGATGTCAATTGTAGCATCTGCCCAGCCTGGTGGTGAGCCCTTGTGCACA
GTC
GATGTATGA


Translation (773 aa):
METYESPSPLPREPAGEAMMENRACPFQVLPHEQSPPPPLQTSSDAEVMDVGSGGDGQSEPPADDPFNFY
G
ASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGV
E
RSTRPECGQLLSPVSGDVHACPFGGSVGNGVGLGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLE
L
DEEGTGGFTAKAIVQRDRVDEEALNFSYE
DDFDNDVDALLEEGLCAPKKRRMEEKYGGDSDHPSDGETS
V
QPMMTKIKTVLK
SRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSI
P
CLHYKKMKDNEEREQNCDLAPSGEVSPVKPLGRSAELDFPLEEPDSMGGDSGSMDEKDPLGAEAAAGAL
G
QVKAKVEVCKDESV
DLEEFRNYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLI
T
LSVQDAPTKK
EFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASS
K
KLAKNKA
ARATLEILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKR
N
HGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGW
CKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGR
E
SSKMVKQ
ETSDKSVIELQQYAKKNRPNLHILSKLQEEMKRLAAEREETRKKPKMSIVASAQPGGEPLCT
V
DV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser