NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27871.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27871.1 Public Mus musculus 15 Igfbp6 16 104 75 CCDS HistoryNCBI Gene:16012Re-query CCDS DB by CCDS ID:27871.1Re-query CCDS DB by GeneID:16012

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27871.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023807 ENSMUSP00000023807 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023807Link to Ensembl Protein Viewer:ENSMUSP00000023807Re-query CCDS DB by Nucleotide ID:ENSMUST00000023807Re-query CCDS DB by Protein ID:ENSMUSP00000023807
Original member Current member EBI,WTSI OTTMUST00000089026 OTTMUSP00000048594 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000089026Link to Vega Protein Viewer:OTTMUSP00000048594Re-query CCDS DB by Nucleotide ID:OTTMUST00000089026Re-query CCDS DB by Protein ID:OTTMUSP00000048594
Original member Current member NCBI NM_008344.3 NP_032370.2 Accepted alive Link to Nucleotide Sequence:NM_008344.3Link to Protein Sequence:NP_032370.2Re-query CCDS DB by Nucleotide ID:NM_008344Re-query CCDS DB by Protein ID:NP_032370Link to BLink:NP_032370.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032370.2 238 P47880 238 100% 0 0

Chromosomal Locations for CCDS 27871.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

Chromosome Start Stop Links
15 102144548 102144884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102147845 102147978 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102148102 102148224 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 102149180 102149302 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (717 nt):
ATGACCTGGGATGGGCTGCCCACGCAGCCGCTGCTCATGCTGCTAATGCTGTTGTTCGCTGCGGGCTCAG
GG
TCCGCCTTAGCGGGGTGCCCCGGCTGCGGCGCTGGGATGCAGACTGGTTGTCGCGGGGGCTGCGTGGA
G
GAGGAAGACGCGGGATCGCCTGCAGACGGCTGTACAGAAGCCGGAGGCTGTCTCAGGAGAGAGGGACAA
CCG
TGCGGGGTCTACAGCCCTAAGTGCGCCCCAGGACTGCAGTGCCAACCCCGAGAGAACGAAGAGGCGC
CT
TTGCGGGCGCTGCTAATCGGCCAGGGCCGCTGTCAACGCGCCAGAGGGCCGTCGGAGGAGACTACAAA
G
GAGAGCAAACCCCAAGGAGGTGCCTCCCGCTCTCGTGACACAAACCACAGAGACCGGCAGAAGAATCCA
CGG
ACCTCTGCTGCCCCTATACGGCCCAATCCTGTTCAAGATAGTGAGATGGGCCCCTGCCGCAGACACT
TG
GATTCAGTACTGCAGCAGCTCCAGACTGAGGTCTTCCGAGGCGGAGCACGTGGGCTCTATGTGCCAAA
C
TGTGACCTCAGAGGCTTCTACCGAAAGCAGCAGTGTCGTTCCTCGCAGGGGAATCGCCGTGGCCCCTGC
TGG
TGTGTGGATCCGATGGGCCAGCCTTTGCCAGTGTCTCCAGATGGTCAAGGAAGCACTCAGTGCTCTG
CC
AGGAGCAGTGGGTGA


Translation (238 aa):
MTWDGLPTQPLLMLLMLLFAAGSGSALAGCPGCGAGMQTGCRGGCVEEEDAGSPADGCTEAGGCLRREGQ
P
CGVYSPKCAPGLQCQPRENEEAPLRALLIGQGRCQRARGPS
EETTKESKPQGGASRSRDTNHRDRQKNP
R
TSAAPIRPNPVQDSEM
GPCRRHLDSVLQQLQTEVFRGGARGLYVPNCDLRGFYRKQQCRSSQGNRRGPC
W
CVDPMGQPLPVSPDGQGSTQCSARSSG




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser