NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27718.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27718.1 Public Mus musculus 15 Smc1b 16 104 75 CCDS HistoryNCBI Gene:140557Re-query CCDS DB by CCDS ID:27718.1Re-query CCDS DB by GeneID:140557

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27718.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000023068 ENSMUSP00000023068 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023068Link to Ensembl Protein Viewer:ENSMUSP00000023068Re-query CCDS DB by Nucleotide ID:ENSMUST00000023068Re-query CCDS DB by Protein ID:ENSMUSP00000023068
Original member Current member NCBI NM_080470.1 NP_536718.1 Accepted alive Link to Nucleotide Sequence:NM_080470.1Link to Protein Sequence:NP_536718.1Re-query CCDS DB by Nucleotide ID:NM_080470Re-query CCDS DB by Protein ID:NP_536718Link to BLink:NP_536718.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_536718.1 1248 Q920F6 1248 100% 0 0

Chromosomal Locations for CCDS 27718.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

Chromosome Start Stop Links
15 85064962 85065105 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85066219 85066329 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85067737 85067806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85069645 85069796 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85070780 85070934 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85071582 85071738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85086093 85086188 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85089592 85089745 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85090872 85091017 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85091943 85092084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85096646 85096752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85097505 85097621 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85097896 85098033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85106918 85107064 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85110652 85110831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85112687 85112872 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85114679 85114886 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85115839 85115921 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85120618 85120758 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85121589 85121847 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85123721 85123959 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85127468 85127671 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85127759 85127871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85129671 85129859 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 85131829 85131937 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3747 nt):
ATGGGGCACCTTGAGCTGCTGCTCGTGGAGAATTTCAAGTCGTGGCGAGGCCGCCAGGTCATCGGCCCTT
TC
AAGAGGTTCACCTGCATCATTGGCCCCAACGGCTCCGGAAAATCTAATGTAATGGATGCACTTAGTTT
T
GTAATGGGAGAAAAGACAACTAATTTAAGAGTAAAAAACATTCAAGAACTTATTCATGGAGCACATACT
GGA
AAACCTGTTTCTTCTTCTGCAAGTGTGACAATTATATACATAGAGGACAGTGGAGAAGAGAAAACAT
TC
ACAAGGATTATCCGAGGGGGGTGCTCAGAATATCATTTTGGGGATAAACCCGTGAGTCGTTCTGTGTA
T
GTAGCCCAGTTGGAAAACATAGGCATAATAGTCAAAGCACAGAACTGTCTAGTTTTTCAGGGAACTGTA
GAG
TCAATATCCATGAAAAAGCCCAAAGAGAGAACCCAGTTTTTTGAAGAAATCAGTACTTCAGGAGAAT
TT
ATAGGAGAATATGAGGCAAAGAAAAAGAAATTACAAAAAGCTGAAGAAGATGCACAATTTCATTTTAA
T
GTGAAAAAAAATGTAGCTGCAGAACGGAAGCATGCAAAAATAGAGAAAGAAGAGGCAGAACATTACCAA
AAT
CTCCTTGAAGAATTGAAAATAAACAAGATACAACTGATGCTTTTCCAACTATATTATAATGAGGAAA
AA
ATCAATGTTTTAAACACTGAATTAGAGCAAATGGACGGGAATTTAAGTGTTGTAAAAGACACTCTTTC
T
CACCATGAAAACATATTTAAAGCTAAGAAAAAGGATTATGGAATGTTAACTAGACAACTACAGCAAACA
GCA
AAAGAACTGAAATCTGTTGAAGCAATTTTAAATCAGAAGAGGCCTCAGTACATTAAGGCTAAAGAAA
AC
ACTTCTCATCATCTAAAAAAATTAGATTTGTCTAAGAAATTGATAACAGACAATGAAAAACAATGTTC
T
AAGCAGGAAGATGGCATACGAGCCTTAGTGGCAGAACTGGCTGATTTGGATAGAGCATGGAAAAGTTTT
GAA
AAGCAGATGGAAGAGAAAATCTTACAAAAAGGGCGAGATATTGAATTGGAAAATAGCCAGCTGGATC
GT
TACAAACTGCTTAAGGAGCAAGTCAGACGGAAGGTTGGTATAATGACACAACAACTGGAAAAACTGCA
G
TGGGAACAGAAGGCAGAAAAAGAAAGACTTGCATTTGAAAAGAGGAGGCATGGAGACACTCAGGGAAAT
CTA
AAACAGATAAAAGAACAAATAGAAGAGCATAAAAAACGAATAGAGAAGTTGGAGGAATATACAAAGA
CG
TGCATGGATTGCTTGGAAGATAAAAAACAGCAAGAAGAGGCCCTGAAAAAAGAAATTGAAAATACGAA
A
TCAAGAATGTCTGAAGTTAATGAAGAATTGAGTCTTATTAGAAATGAATTGCAGAATGCTGGAATTGAT
AAC
CATGAGGGAAAACGTCAGCAGAAAAGAGCAGAAGTTCTGGAACACCTTAAAAGACTTTACCCAGATT
CT
GTGTTTGGAAGACTGCTTGATCTGTGTCATCCTATTCATAAGAAGTACCAGCTGGCTGTGACTAAGCT
T
TTTGGCCGGTACATGGTTGCCATTGTTGTAGCCTCAGAAAAGATAGCGAAAGATTGTATTCGATTTCTG
AAG
GCAGAAAGAGCTGAACCTGAGACATTCCTTGCTCTAGATTACCTTGATATCAAGCCAATCAATGAAC
GA
CTAAGGGAAATTAAAGGCTGTAAGATGATGATCGATGTTATAAAGACCCAGTTTCCTCAGCTGAAGAA
A
GTGATTCAGTTTGTTTGTGGAAATGGCCTTGTCTGTGAGACTGTGGAAGAAGCAAGACATATTGCATTC
GGT
GGACCTGAAAGACGGAAGGCAGTAGCACTTGATGGAACACTGTTTTTGAAATCTGGAGTGATTTCTG
GA
GGGTCAAGTGACTTAAAGCACAAAGCTCTGTGCTGGGATGAGAAAGAGTTACACAATCTAAGAGACAA
A
AGAAGCCAACTAGTCCAAGAGCTAAAGGAGTTAATGAAGACACTCCGCAAGGAAACAGATCTGAAGCAA
ATA
CAGACTTTAGTACAAGGAACCAATACACGACTCAAATATTCACAAAATGAACTAGAGATGATTAAAA
AG
AAGCACCTTGCTACATTTTACCGGGAACAATCTCAGCTACAAAGTGAATTACTGAATATTGATTCTCA
A
TGTACTATGTTGAGTGAAGGAATCAACAAACAGCAACAAAAAATTGAAGAATTTCAAGATAAGATAGAT
GAG
GTAGAAGATGACATATTCCAAGACTTCTGTGAAGAAATTGGTGTGGAAAATATCCGTGAATTTGAGA
AT
AAACATGTTAAACAGCAGCAAGAAAATGATCAAAAAAGATTAGAGTTTGAAAAACAAAAAACTCGGCT
T
AATATTCAGCTCGAATATAGTCGAAATCAGCTTAAGAAGAAACTGAATAATATCGACACATTAAAAACC
ACA
ATCCAGAAGGGCAAAGAAGATATTGATAACCTAAAAAAGACCGAAGAAGAATGTCTGAAAATTGTTG
AG
GAACTCATGGTGAAGCAAGAGCAAATTAAGGAAGTGCTTGCCACACAGAGTTCCAACATTGAAAAAAT
T
CACATACAAATTGAAGAGGAACGCAAGAAGGTTTTGGCTGTTGATAGGGAAGTTGGAAAATTACAGAAG
GAA
GTTGTAATCATTCAGGGTTCTTTGGAACAGAAACTGCTAGAGAAACATAACTTGCTGCTAGATTGCA
AA
GTTCAAGACATTGACATAAGTCTTGTGCTGGGGTCATTGGAGGACATCATTGAAATGGAGCTAACTGA
A
ACAGAAAGCACCCAGGCAACAGCTGATATCTATGAGAAAGAAGCATCCATCCAAATAGACTACAGCCCT
CTA
AGGGAGGATTTAAAGGCTCTACAATCAGATAAGGAGGTGGAGGCCCACCTTACACTCCTTCTACAGC
AA
GTAGCATCCCAAGAAAACACTCTACTGAAGACTACAGCTCCAAACTTGCGAGCACAGGAGAACTTAAA
G
ACTGTCAGAGACAAGTTTCAAGAATCTGCAGATGTTTTTGAGGCCAGCAGAAAGGAAGCCAGAATATGT
AGG
CAAGAGTTTGAACAGGTGAAAAGACGGAGGTACGATGCTTTCAGTCAATGTTTTGAACACATCTCAG
TC
TCAATTGATCAAATCTACAAGAAGCTCTGCAGGAACAACAGTGCCCAGGCATTTCTTAGCCCAGAGAA
C
CCTGAAGAACCTTACTTAGATGGAATTAGCTACAACTGTGTGGCTCCAGGCAAACGGTTCATGCCCATG
GAC
AACCTGTCAGGGGGAGAAAAGTGTGTGGCTGCTCTGGCTCTTCTGTTTGCTGTACACAGTTTTCGGC
CT
GCTCCATTCTTTGTATTAGATGAAGTAGATGCAGCCCTGGACAATACTAACATTGGCAAAGTCTCAAG
T
TACATCAAAGAGCAGAGTCAGGAACAGTTTCAGATGATAATCATTTCCCTGAAAGAGGAGTTCTACTCC
AAA
GCTGATGCACTGATAGGCGTCTACCCAGAGCACAATGAGTGCATGTTCAGCCATGTGTTGACTCTGG
AC
CTTTCCAAGTATCCAGACACCGAAGACCAAGAAGGCAGCAGGAGCCACCGGAAGCCCAGAGTACCACG
A
GTATCAATGTCTCCAAAGTCTCCCCAGTCTCGTTAG


Translation (1248 aa):
MGHLELLLVENFKSWRGRQVIGPFKRFTCIIGPNGSGKSNVMDALSFVMGEKTTNLRVKNIQELIHGAHT
G
KPVSSSASVTIIYIEDSGEEKTFTRIIR
GGCSEYHFGDKPVSRSVYVAQLENIGIIVKAQNCLVFQGTV
E
SISMKKPKERTQFFEEISTSGEFIGEYEAKKKKLQKAEEDAQFHFNVKKNVAAERKHAKIEKEE
AEHYQ
N
LLEELKINKIQLMLFQLYYNEEKINVLNTELEQMDGNLSVVKDTLSHHENIFKAKKKDYGMLTRQLQQT
A
KEL
KSVEAILNQKRPQYIKAKENTSHHLKKLDLSKKLITDNEKQCSKQEDGIRALVAELADLDRAWKSF
E
KQMEEKILQKGRDIELENSQ
LDRYKLLKEQVRRKVGIMTQQLEKLQWEQKAEKERLAFEKRRHGDTQGN
L
KQIKEQIEEHKKRIEKLEEYTKTC
MDCLEDKKQQEEALKKEIENTKSRMSEVNEELSLIRNELQNAGID
N
HEGKRQQKRAEVLEHLKRLYPDSV
FGRLLDLCHPIHKKYQLAVTKLFGRYMVAIVVASEKIAKDCIRFL
K
AERAEPETFLALDYLD
IKPINERLREIKGCKMMIDVIKTQFPQLKKVIQFVCGNGLVCETVEEARHIAF
G
GPERRK
AVALDGTLFLKSGVISGGSSDLKHKALCWDEKELHNLRDKRSQLVQELKELMKTLRKETDLKQ
I
QTLVQGTNTRLKYSQNELEMIKKKHLATFYR
EQSQLQSELLNIDSQCTMLSEGINKQQQKIEEFQDKID
E
VEDDIFQDFCEEIGVENIREFENKHVKQQQENDQKRLEFEKQKTRLNIQLEYSRNQLKKKLNNIDTLKT
T
IQKGKEDIDNLKK
TEEECLKIVEELMVKQEQIKEVLATQSSNIEKIHIQIEEERKKVLAVDREVGKLQK
E
VVIIQGSLEQKLLEKHNLLLDCKVQDIDISLVLGSLEDIIEME
LTETESTQATADIYEKEASIQIDYSP
L
REDLK
ALQSDKEVEAHLTLLLQQVASQENTLLKTTAPNLRAQENLKTVRDKFQESADVFEASRKEARIC
R
QEFEQVKRRRYDAFSQCFEHISVSIDQIYKKLCRNNSAQ
AFLSPENPEEPYLDGISYNCVAPGKRFMPM
D
NLSGGEKCVAALALLFAVH
SFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQSQEQFQMIIISLKEEFYS
K
ADALIGVYPE
HNECMFSHVLTLDLSKYPDTEDQEGSRSHRKPRVPRVSMSPKSPQSR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser