NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27311.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27311.1 Public Mus musculus 14 Klf5 16 104 75 CCDS HistoryNCBI Gene:12224Re-query CCDS DB by CCDS ID:27311.1Re-query CCDS DB by GeneID:12224

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27311.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000005279 ENSMUSP00000005279 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000005279Link to Ensembl Protein Viewer:ENSMUSP00000005279Re-query CCDS DB by Nucleotide ID:ENSMUST00000005279Re-query CCDS DB by Protein ID:ENSMUSP00000005279
Original member Current member NCBI NM_009769.4 NP_033899.2 Accepted alive Link to Nucleotide Sequence:NM_009769.4Link to Protein Sequence:NP_033899.2Re-query CCDS DB by Nucleotide ID:NM_009769Re-query CCDS DB by Protein ID:NP_033899Link to BLink:NP_033899.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033899.2 446 Q9Z0Z7 446 100% 0 0

Chromosomal Locations for CCDS 27311.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

Chromosome Start Stop Links
14 99298995 99299222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 99301381 99302254 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 99303418 99303477 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 99313151 99313329 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1341 nt):
ATGCCCACGCGGGTGCTGACCATGAGCGCCCGCCTGGGACCACTGCCCCAGCCGCCGGCCGCGCAGGACG
AG
CCCGTGTTCGCGCAGCTCAAGCCGGTGCTGGGCGCTGCGAACCCGGCCCGCGACGCGGCGCTCTTCTC
C
GGAGACGATCTGAAACACGCGCACCACCACCCGCCTGCGCCGCCGCCAGCCGCTGGCCCGCGACTGCCC
TCG
GAGGAGCTGGTCCAGACAAGATGTGAAATGGAGAAGTATCTGACCCCTCAGCTCCCTCCAGTTCCGA
TA
ATTTCAGAGCATAAAAAGTATAGACGAGACAGTGCCTCAGTGGTAGACCAGTTCTTCACTGACACTGA
A
GGCATACCTTACAGCATCAACATGAACGTCTTCCTCCCTGACATCACTCACCTGAGAACTGGCCTCTAC
AAA
TCCCAGAGACCATGCGTAACACAGATCAAGACAGAACCTGTTACCATTTTCAGCCACCAGAGCGAGT
CG
ACGGCCCCTCCTCCTCCTCCGGCCCCCACCCAGGCTCTCCCCGAGTTCACTAGTATCTTCAGCTCCCA
C
CAGACCACAGCGCCACCACAGGAGGTGAACAATATCTTCATCAAACAAGAACTTCCTATACCAGATCTT
CAT
CTCTCTGTCCCTTCCCAGCAGGGCCACCTGTACCAGCTGTTGAATACACCGGATCTAGACATGCCCA
GT
TCGACAAACCAGACGGCAGTAATGGACACCCTTAATGTTTCTATGGCAGGCCTTAACCCACACCCCTC
T
GCTGTTCCACAGACGTCAATGAAACAGTTCCAGGGCATGCCCCCTTGCACGTACACCATGCCAAGTCAG
TTT
CTTCCACAGCAGGCCACCTACTTTCCCCCGTCACCACCAAGCTCAGAGCCTGGAAGTCCCGATAGAC
AA
GCTGAGATGCTGCAGAATCTCACCCCACCTCCGTCCTATGCCGCTACAATTGCTTCCAAACTGGCGAT
T
CACAACCCAAATTTACCTGCCACTCTGCCAGTTAATTCGCCAACTCTCCCACCTGTCAGATACAACAGA
AGG
AGTAACCCGGATCTGGAGAAGCGACGTATCCACTTCTGCGATTATAATGGTTGCACAAAAGTTTATA
CA
AAGTCGTCTCACTTAAAAGCTCACCTGAGGACTCATACGGGCGAGAAGCCCTACAAGTGCACCTGGGA
G
GGCTGCGACTGGAGGTTTGCCCGGTCGGATGAGCTGACCCGCCACTACAGGAAGCACACGGGCGCCAAG
CCG
TTCCAGTGCATGGTGTGCCAACGCAGCTTCTCCCGCTCCGACCACCTCGCGCTGCACATGAAGCGCC
AC
CAGAACTGA


Translation (446 aa):
MPTRVLTMSARLGPLPQPPAAQDEPVFAQLKPVLGAANPARDAALFSGDDLKHAHHHPPAPPPAAGPRLP
S
EELVQ
TRCEMEKYLTPQLPPVPIISEHKKYRRDSASVVDQFFTDTEGIPYSINMNVFLPDITHLRTGLY
K
SQRPCVTQIKTEPVTIFSHQSESTAPPPPPAPTQALPEFTSIFSSHQTTAPPQEVNNIFIKQELPIPDL
H
LSVPSQQGHLYQLLNTPDLDMPSSTNQTAVMDTLNVSMAGLNPHPSAVPQTSMKQFQGMPPCTYTMPSQ
F
LPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPATLPVNSPTLPPVRYNR
R
SNPDLEKRRIHFCDYN
GCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAK
P
FQCMVCQRSFSRSDHLALHMKRHQN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser