NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27027.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27027.1 Public Mus musculus 14 Apex1 16 104 75 CCDS HistoryNCBI Gene:11792Re-query CCDS DB by CCDS ID:27027.1Re-query CCDS DB by GeneID:11792See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 27027.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000049411 ENSMUSP00000042602 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000049411Link to Ensembl Protein Viewer:ENSMUSP00000042602Re-query CCDS DB by Nucleotide ID:ENSMUST00000049411Re-query CCDS DB by Protein ID:ENSMUSP00000042602
Original member Current member EBI,WTSI OTTMUST00000047275 OTTMUSP00000021336 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000047275Link to Vega Protein Viewer:OTTMUSP00000021336Re-query CCDS DB by Nucleotide ID:OTTMUST00000047275Re-query CCDS DB by Protein ID:OTTMUSP00000021336
Original member Current member NCBI NM_009687.2 NP_033817.1 Accepted alive Link to Nucleotide Sequence:NM_009687.2Link to Protein Sequence:NP_033817.1Re-query CCDS DB by Nucleotide ID:NM_009687Re-query CCDS DB by Protein ID:NP_033817Link to BLink:NP_033817.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033817.1 317 P28352 317 100% 0 0

Chromosomal Locations for CCDS 27027.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 14Link to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 50925270 50925324 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 50925517 50925704 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 50926161 50926353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14
14 50926456 50926973 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14Link to Vega Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (954 nt):
ATGCCAAAGCGGGGAAAGAAAGCGGCGGCCGACGACGGGGAAGAACCCAAGTCGGAGCCAGAGACCAAGA
AG
AGTAAGGGGGCAGCAAAGAAAACCGAGAAGGAGGCCGCGGGAGAGGGCCCTGTCCTGTACGAGGACCC
T
CCAGATCAGAAAACCTCACCCAGTGGCAAATCTGCCACACTCAAGATATGCTCCTGGAATGTGGATGGG
CTT
CGAGCCTGGATTAAAAAGAAAGGTTTGGATTGGGTAAAGGAAGAAGCACCAGATATCTTGTGCCTCC
AA
GAGACCAAGTGCTCGGAGAACAAACTCCCGGCTGAACTGCAAGAGCTGCCTGGACTCACCCATCAGTA
C
TGGTCAGCTCCGTCAGACAAAGAAGGATACAGTGGTGTGGGCCTACTTTCCCGCCAGTGCCCGCTAAAA
GTC
TCTTATGGCATTGGCGAGGAAGAACATGATCAAGAAGGCCGGGTGATTGTGGCTGAATTTGAGTCCT
TT
GTCCTGGTAACAGCCTATGTTCCCAATGCAGGCAGGGGTCTGGTAAGACTGGAATACCGACAGCGTTG
G
GATGAAGCCTTCCGAAAGTTTCTAAAGGACTTGGCTTCCAGAAAGCCTCTTGTGCTATGTGGGGATCTC
AAT
GTGGCTCATGAAGAAATTGACCTCCGTAACCCCAAAGGAAACAAAAAGAATGCTGGCTTTACTCCCC
AG
GAGCGCCAAGGTTTTGGGGAACTGCTACAAGCTGTACCATTGGCTGACAGCTTCCGGCATCTCTACCC
C
AACACTGCTTACGCTTACACTTTCTGGACTTACATGATGAATGCCCGCTCTAAGAATGTTGGTTGGCGC
CTT
GATTACTTTTTGCTTTCCCACTCTCTTTTACCTGCATTGTGTGACAGCAAGATCCGGTCCAAGGCTC
TT
GGCAGTGACCACTGTCCCATCACCCTTTACCTAGCACTGTGA


Translation (317 aa):
MPKRGKKAAADDGEEPKSEPETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSPSGKSATLKICSWNVDG
L
RAWIKKKGLD
WVKEEAPDILCLQETKCSENKLPAELQELPGLTHQYWSAPSDKEGYSGVGLLSRQCPLK
V
SYGI
GEEEHDQEGRVIVAEFESFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKDLASRKPLVLCGDL
N
VAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTAYAYTFWTYMMNARSKNVGWR
L
DYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser