NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26166.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26166.1 Public Mus musculus 12 Wars 16 104 75 CCDS HistoryNCBI Gene:22375Re-query CCDS DB by CCDS ID:26166.1Re-query CCDS DB by GeneID:22375

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 26166.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000161154 ENSMUSP00000124625 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000161154Link to Ensembl Protein Viewer:ENSMUSP00000124625Re-query CCDS DB by Nucleotide ID:ENSMUST00000161154Re-query CCDS DB by Protein ID:ENSMUSP00000124625
Original member Current member EBI,WTSI OTTMUST00000088865 OTTMUSP00000048496 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000088865Link to Vega Protein Viewer:OTTMUSP00000048496Re-query CCDS DB by Nucleotide ID:OTTMUST00000088865Re-query CCDS DB by Protein ID:OTTMUSP00000048496
Original member Current member NCBI NM_011710.3 NP_035840.3 Accepted alive Link to Nucleotide Sequence:NM_011710.3Link to Protein Sequence:NP_035840.3Re-query CCDS DB by Nucleotide ID:NM_011710Re-query CCDS DB by Protein ID:NP_035840Link to BLink:NP_035840.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035840.3 481 P32921-1 481 100% 0 0

Chromosomal Locations for CCDS 26166.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

Chromosome Start Stop Links
12 108860312 108860333 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 108861269 108861426 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 108862803 108862943 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 108866013 108866299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 108867677 108867777 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 108875114 108875296 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 108875666 108875785 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 108881043 108881151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 108882695 108882908 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 108888376 108888486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1446 nt):
ATGGCAGACATGCCCAGTGGCGAGTCCTGCACCTCTCCACTGGAGCTGTTCAACAGCATAGCTACTCAAG
GG
GAGCTCGTGAGGTCCCTCAAAGCTGGAAATGCACCAAAAGATGAGATTGATTCTGCAGTAAAGATGTT
G
TTATCATTAAAAATGAGCTATAAGGCCGCCATGGGGGAGGAGTACAAGGCTGGCTGCCCTCCTGGGAAC
CCA
ACAGCTGGGAGAAATTGTGACTCTGATGCCACAAAAGCCAGCGAGGATTTTGTGGATCCATGGACGG
TG
CGGACAAGCAGTGCAAAAGGCATCGACTATGACAAGCTCATTGTTCAGTTTGGAAGCAGCAAAATTGA
C
AAAGAGCTGATAAACCGAATAGAGCGAGCCACTGGCCAAAGACCGCACCGCTTCCTGCGCCGGGGCATC
TTC
TTCTCCCACCGAGATATGAATCAAATTCTGGATGCCTATGAAAATAAGAAGCCATTCTACCTGTACA
CA
GGCAGGGGCCCCTCCTCCGAAGCAATGCATCTGGGTCATCTCGTCCCGTTTATTTTCACAAAGTGGCT
A
CAGGATGTGTTCAATGTGCCTTTGGTCATCCAGATGTCTGACGACGAGAAGTACCTGTGGAAGGACTTG
ACT
CTGGAGCAGGCATATAGCTACACCGTAGAAAATGCAAAGGACATCATTGCCTGTGGCTTCGACATCA
AC
AAAACTTTCATCTTCTCTGATCTTGAGTATATGGGGCAGAGCCCGGGCTTCTACAGGAACGTGGTGAA
G
ATTCAGAAGCACGTCACCTTCAACCAAGTGAAAGGCATTTTCGGCTTTACGGACAGTGACTGCATCGGG
AAG
ATCAGTTTTCCTGCTGTCCAGGCCGCGCCATCGTTCAGCAACTCTTTCCCGAAGATCTTCCGAGACA
GG
ACAGATATCCAGTGCCTCATCCCGTGTGCCATTGACCAGGATCCGTACTTCAGAATGACAAGGGACGT
G
GCCCCCAGGATCGGCCATCCTAAACCTGCCCTGCTGCACTCGACCTTCTTCCCTGCCCTGCAGGGCGCT
CAG
ACCAAGATGAGTGCCAGTGACCCCAACTCCTCCATCTTCCTCACTGACACGGCCAAGCAGATCAAGA
GC
AAGGTCAACAAGCATGCATTTTCTGGAGGAAGAGATACTGTGGAGGAGCACAGGCAGTTTGGGGGCAA
C
TGTGAAGTGGATGTATCCTTCATGTATCTGACCTTCTTCCTTGAAGATGACGACAGGCTGGAGCAGATC
AGA
AAGGATTACACCAGCGGAGCCATGCTCACCGGGGAGCTCAAGAAGACGCTCATAGACGTCCTTCAGC
CC
CTGATCGCAGAGCACCAGGCCCGACGCAAGGCGGTCACTGAGGAGACCGTGAAGGAGTTCATGACGCC
C
CGGCAGCTGTCCTTCCACTTCCAGTGCTTCTGCTTTGACACTTGA


Translation (481 aa):
MADMPSGESCTSPLELFNSIATQGELVRSLKAGNAPKDEIDSAVKMLLSLKMSYKAAMGEEYKAGCPPGN
P
TAGRNCDSDATKASEDFVDPWTVRTSSAKGIDYDKLI
VQFGSSKIDKELINRIERATGQRPHRFLRRGI
F
FSH
RDMNQILDAYENKKPFYLYTGRGPSSEAMHLGHLVPFIFTKWLQDVFNVPLVIQMSDDEKYLWKDL
T
LEQAYSYTVENAKDIIACGFDINKTFIFSDLEYM
GQSPGFYRNVVKIQKHVTFNQVKGIFGFTDSDCIG
K
ISFPAVQAAPSFSNSFPKIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGHPKPALLHSTFFPALQGA
Q
TKMSASDPNSSIFLTDTAKQIKSK
VNKHAFSGGRDTVEEHRQFGGNCEVDVSFMYLTFFLEDDDRLEQI
R
K
DYTSGAMLTGELKKTLIDVLQPLIAEHQARRKAVTEETVKEFMTPRQLSFHFQCFCFDT



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser