NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25133.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25133.1 Public Mus musculus 11 Psmd11 16 104 75 CCDS HistoryNCBI Gene:69077Re-query CCDS DB by CCDS ID:25133.1Re-query CCDS DB by GeneID:69077See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 25133.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000017572 ENSMUSP00000017572 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000017572Link to Ensembl Protein Viewer:ENSMUSP00000017572Re-query CCDS DB by Nucleotide ID:ENSMUST00000017572Re-query CCDS DB by Protein ID:ENSMUSP00000017572
Original member Current member EBI,WTSI ENSMUST00000173938 ENSMUSP00000133571 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000173938Link to Ensembl Protein Viewer:ENSMUSP00000133571Re-query CCDS DB by Nucleotide ID:ENSMUST00000173938Re-query CCDS DB by Protein ID:ENSMUSP00000133571
Original member Current member EBI,WTSI OTTMUST00000000625 OTTMUSP00000000274 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000000625Link to Vega Protein Viewer:OTTMUSP00000000274Re-query CCDS DB by Nucleotide ID:OTTMUST00000000625Re-query CCDS DB by Protein ID:OTTMUSP00000000274
Original member Current member EBI,WTSI OTTMUST00000096373 OTTMUSP00000053827 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000096373Link to Vega Protein Viewer:OTTMUSP00000053827Re-query CCDS DB by Nucleotide ID:OTTMUST00000096373Re-query CCDS DB by Protein ID:OTTMUSP00000053827
Original member Current member NCBI NM_178616.3 NP_848731.2 Accepted alive Link to Nucleotide Sequence:NM_178616.3Link to Protein Sequence:NP_848731.2Re-query CCDS DB by Nucleotide ID:NM_178616Re-query CCDS DB by Protein ID:NP_848731Link to BLink:NP_848731.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_848731.2 422 Q8BG32 422 100% 0 0

Chromosomal Locations for CCDS 25133.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 80428665 80428755 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80431705 80431806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80438251 80438375 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80445242 80445313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80445914 80445971 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80456240 80456434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80460596 80460740 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80462611 80462671 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80465014 80465076 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80469802 80469927 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80470383 80470418 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80470626 80470677 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 80471452 80471594 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1269 nt):
ATGGCGGCCGCAGCGGTGGTGGAGTTCCAGAGAGCCCAGTCTCTACTCAGCACCGACCGGGAGGCCTCCA
TC
GACATCCTCCACTCCATCGTGAAACGTGACATTCAAGAAAATGATGAGGAGGCAGTCCAGGTCAAAGA
G
CAGAGCATCCTTGAACTGGGTTCTCTCCTGGCGAAGACTGGACAAGCTGCTGAGCTTGGAGGACTCCTG
AAG
TATGTACGGCCTTTCTTGAATTCCATCAGTAAAGCTAAAGCAGCTCGTCTGGTCCGGTCTCTTCTTG
AT
CTGTTTCTAGATATGGAAGCAGCCACAGGGCAGGAGGTCGAGCTATGTTTAGAGTGCATCGAATGGGC
C
AAATCAGAGAAAAGAACTTTCTTACGCCAAGCATTGGAGGCAAGGCTGGTGTCTTTGTATTTTGATACC
AAG
AGGTACCAGGAAGCATTGCATTTGGGTTCTCAGCTGCTTCGGGAGTTGAAAAAGATGGATGATAAAG
CC
CTTTTGGTGGAAGTACAGCTTTTAGAAAGCAAAACTTACCATGCTCTGAGTAATCTGCCGAAAGCCCG
A
GCTGCCTTAACCTCTGCTCGAACCACAGCAAATGCCATCTACTGCCCCCCTAAATTGCAGGCCACCCTG
GAC
ATGCAGTCAGGCATTATTCATGCAGCAGAGGAGAAGGACTGGAAAACTGCATACTCATACTTCTATG
AG
GCATTCGAAGGCTACGACTCCATTGATAGCCCCAAGGCCATCACATCTCTGAAGTACATGTTGCTGTG
C
AAAATCATGCTCAACACCCCAGAAGATGTCCAGGCTTTGGTGAGCGGAAAGCTTGCACTTCGGTATGCA
GGG
AGGCAGACAGAAGCATTGAAATGTGTGGCTCAAGCTAGCAAGAACAGATCACTGGCAGATTTTGAAA
AG
GCCCTGACAGACTACAGGGCAGAGCTCCGGGATGACCCAATCATCAGCACACATTTGGCCAAGCTGTA
C
GATAACTTACTGGAACAGAATCTGATCCGGGTCATCGAGCCTTTTTCCCGAGTCCAGATTGAACACATA
TCT
AGCCTCATCAAACTCTCCAAGGCCGACGTGGAAAGAAAATTATCACAGATGATTCTTGACAAGAAGT
TT
CATGGGATTTTGGACCAGGGGGAGGGTGTCCTGATCATTTTCGATGAACCCCCAGTAGATAAAACTTA
T
GAAGCTGCTCTGGAAACTATTCAGAACATGAGTAAAGTAGTGGACTCCCTCTACAGCAAAGCCAAGAAG
CTG
ACATAG


Translation (422 aa):
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLL
K
YVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQE
VELCLECIEWAKSEKRTFLRQALEARLVSLYFDT
K
RYQEALHL
GSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATL
D
MQS
GIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYA
G
RQ
TEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHI
S
SLIKLSK
ADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKK
L
T




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser