NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24693.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24693.1 Public Mus musculus 11 Il3 16 104 75 CCDS HistoryNCBI Gene:16187Re-query CCDS DB by CCDS ID:24693.1Re-query CCDS DB by GeneID:16187

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24693.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000019058 ENSMUSP00000019058 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000019058Link to Ensembl Protein Viewer:ENSMUSP00000019058Re-query CCDS DB by Nucleotide ID:ENSMUST00000019058Re-query CCDS DB by Protein ID:ENSMUSP00000019058
Original member Current member EBI,WTSI OTTMUST00000012597 OTTMUSP00000005831 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012597Link to Vega Protein Viewer:OTTMUSP00000005831Re-query CCDS DB by Nucleotide ID:OTTMUST00000012597Re-query CCDS DB by Protein ID:OTTMUSP00000005831
Original member Current member NCBI NM_010556.4 NP_034686.2 Accepted alive Link to Nucleotide Sequence:NM_010556.4Link to Protein Sequence:NP_034686.2Re-query CCDS DB by Nucleotide ID:NM_010556Re-query CCDS DB by Protein ID:NP_034686Link to BLink:NP_034686.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034686.2 166 P01586 166 100% 0 0

Chromosomal Locations for CCDS 24693.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

Chromosome Start Stop Links
11 54265404 54265559 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 54265682 54265723 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 54265859 54265954 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 54266948 54266989 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 54267086 54267250 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (501 nt):
ATGGTTCTTGCCAGCTCTACCACCAGCATCCACACCATGCTGCTCCTGCTCCTGATGCTCTTCCACCTGG
GA
CTCCAAGCTTCAATCAGTGGCCGGGATACCCACCGTTTAACCAGAACGTTGAATTGCAGCTCTATTGT
C
AAGGAGATTATAGGGAAGCTCCCAGAACCTGAACTCAAAACTGATGATGAAGGACCCTCTCTGAGGAAT
AAG
AGCTTTCGGAGAGTAAACCTGTCCAAATTCGTGGAAAGCCAAGGAGAAGTGGATCCTGAGGACAGAT
AC
GTTATCAAGTCCAATCTTCAGAAACTTAACTGTTGCCTGCCTACATCTGCGAATGACTCTGCGCTGCC
A
GGGGTCTTCATTCGAGATCTGGATGACTTTCGGAAGAAACTGAGATTCTACATGGTCCACCTTAACGAT
CTG
GAGACAGTGCTAACCTCTAGACCACCTCAGCCCGCATCTGGCTCCGTCTCTCCTAACCGTGGAACCG
TG
GAATGTTAA


Translation (166 aa):
MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRN
K
SFRRVNLSKFVESQGEVDPEDRYVIKSNLQ
KLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLND
L
ETVLTSRPPQPASGSVSPNRGTVEC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser