NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24283.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24283.1 Public Mus musculus 10 Erbb3 16 104 75 CCDS HistoryNCBI Gene:13867Re-query CCDS DB by CCDS ID:24283.1Re-query CCDS DB by GeneID:13867

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24283.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000082059 ENSMUSP00000080716 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000082059Link to Ensembl Protein Viewer:ENSMUSP00000080716Re-query CCDS DB by Nucleotide ID:ENSMUST00000082059Re-query CCDS DB by Protein ID:ENSMUSP00000080716
Original member Current member EBI,WTSI OTTMUST00000074150 OTTMUSP00000038495 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000074150Link to Vega Protein Viewer:OTTMUSP00000038495Re-query CCDS DB by Nucleotide ID:OTTMUST00000074150Re-query CCDS DB by Protein ID:OTTMUSP00000038495
Original member Current member NCBI NM_010153.1 NP_034283.1 Accepted alive Link to Nucleotide Sequence:NM_010153.1Link to Protein Sequence:NP_034283.1Re-query CCDS DB by Nucleotide ID:NM_010153Re-query CCDS DB by Protein ID:NP_034283Link to BLink:NP_034283.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034283.1 1339 Q61526 1339 100% 0 0

Chromosomal Locations for CCDS 24283.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

Chromosome Start Stop Links
10 128569368 128569894 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128570054 128570354 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128570936 128571007 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128571170 128571358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128571446 128571543 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128571645 128571791 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128572129 128572204 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128572434 128572589 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128572759 128572944 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128573175 128573273 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128573412 128573531 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128574339 128574474 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128575982 128576035 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128576861 128577015 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128577204 128577294 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128578100 128578232 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128578394 128578599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128579002 128579092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128579496 128579569 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128581764 128581884 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128581990 128582103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128583117 128583258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128583366 128583484 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128583637 128583702 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128584311 128584436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128585012 128585198 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128586140 128586291 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 128589420 128589501 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4020 nt):
ATGAGTGCGATTGGGACTCTGCAGGTGCTGGGTTTCCTTCTCAGCCTGGCCCGGGGTTCCGAGATGGGCA
AC
TCTCAGGCAGTATGTCCTGGGACTCTAAACGGGCTGAGTGTGACCGGCGATGCTGACAACCAGTACCA
G
ACACTGTACAAACTCTATGAGAAGTGTGAGGTGGTCATGGGTAACCTGGAGATTGTGCTTACGGGACAC
AAT
GCTGATCTTTCCTTCCTGCAATGGATCCGAGAAGTGACAGGCTATGTACTGGTGGCCATGAATGAAT
TC
TCTGTACTGCCCTTACCTAACCTCCGAGTGGTCCGGGGAACCCAGGTCTACGATGGGAAGTTTGCCAT
C
TTTGTCATGTTGAACTACAATACCAACTCCAGCCATGCTCTGCGCCAGCTCCGGTTCACTCAGCTTACT
G
AG
ATTCTGTTAGGGGGCGTTTACATTGAGAAGAATGACAAACTTTGCCACATGGATACAATTGACTGGA
GG
GACATCGTGAGGGTTCCAGACGCTGAGATAGTGGTGAAGAACAACGGGGGGAACTGTCCACCCTGTCA
C
GAAGTCTGCAAGGGGCGATGCTGGGGGCCTGGACCAGAAGACTGCCAGATATTGACCAAGACCATCTGT
GCC
CCTCAGTGTAACGGTCGCTGCTTCGGGCCCAATCCTAACCAGTGCTGCCACGATGAATGTGCAGGTG
GC
TGCTCTGGACCCCAGGACACAGATTGCTTCGCCTGCCGACACTTCAATGACAGTGGTGCCTGTGTGCC
C
AGGTGTCCAGCGCCCCTTGTGTACAACAAGCTAACGTTCCAGCTTGAGCCCAACCCCCATATCAAGTAT
CAG
TACGGAGGAGTCTGTGTTGCCAGTTGTCCCCATAACTTTGTGGTGGATCAGACATTTTGTGTCAGGG
CT
TGTCCTGCTGACAAGATGGAAGTAGATAAGAATGGACTCAAGATGTGTGAGCCTTGCAGAGGGCTGTG
C
CCAAAAGCCTGTGAGGGGACGGGCTCTGGAAGCCGCTACCAGACCGTGGACTCTAGCAATATCGATGGG
TTC
GTGAACTGTACCAAGATCCTGGGCAACCTGGACTTCCTCATCACTGGCCTCAATGGTGACCCCTGGC
AC
AAGATCCCTGCACTGGACCCGGAAAAGCTCAATGTTTTCAGGACAGTCCGGGAGATTACAGGCTACCT
A
AACATCCAGTCCTGGCCCCCTCACATGCACAACTTCAGTGTTTTTTCCAACCTGACGACCATCGGGGGC
AGA
AGCCTCTACAATCGGGGCTTCTCCTTGTTGATCATGAAGAACTTGAATGTCACGTCTCTGGGCTTCC
GG
TCCCTGAAGGAAATTAGTGCTGGGCGTGTCTACATAAGTGCCAATCAGCAACTTTGTTACCACCACTC
T
CTGAACTGGACCAGACTTCTGCGGGGGCCCGCAGAGGAGAGACTTGACATCAAGTACAACCGGCCTCTG
GGA
GAATGCGTGGCAGAGGGCAAAGTGTGTGATCCACTGTGCTCCTCTGGGGGATGCTGGGGCCCAGGCC
CT
GGTCAGTGCTTGTCTTGTCGAAACTACAGCCGGGAAGGTGTCTGTGTGACTCACTGCAACGTTCTGCA
A
GGGGAACCCCGAGAGTTTGTTCATGAGGCTCATTGCTTCTCCTGCCATCCAGAATGCCAGCCCATGGAG
GGC
ACCAGCACGTGCAATGGCTCGGGCTCCGACGCTTGTGCTCGATGCGCCCATTTTCGTGATGGGCCCC
AC
TGTGTGAACAGCTGCCCCCATGGAATCCTAGGTGCCAAAGGTCCAATCTACAAATATCCAGATGCTCA
G
AATGAGTGCCGGCCCTGCCACGAGAACTGCACCCAAGGGTGTAAGGGACCAGAACTACAAGACTGTTTA
GGC
CAAGCAGAGGTATTAATGAGCAAACCACACCTGGTCATAGCGGTGACAGTAGGACTGACTGTGATCT
TC
CTGATTCTGGGAGGCTCTTTTCTCTATTGGCGTGGACGCAGGATTCAGAATAAAAGGGCTATGAGACG
C
TACTTGGAGCGGGGTGAGAGCATCGAGCCTCTGGACCCAAGCGAGAAGGCAAACAAAGTCTTGGCTAGA
ATC
TTCAAAGAGACAGAGCTGAGGAAACTTAAGGTGCTTGGCTCTGGTGTCTTTGGAACTGTACACAAGG
GG
ATTTGGATTCCCGAGGGTGAATCCATCAAGATTCCAGTCTGCATTAAAGTCATCGAGGACAAGAGTGG
G
CGGCAGAGTTTTCAGGCTGTGACTGATCACATGCTGGCCGTCGGCAGCCTGGACCATGCCCACATTGTA
CGG
CTGCTGGGACTGTGCCCAGGGTCATCTCTGCAGCTTGTCACTCAGTACTTGCCTCTGGGCTCTCTCC
TT
GATCATGTAAGACAGCACCGTGAGACACTGGGACCACAGCTGCTGCTCAACTGGGGAGTACAAATTGC
C
AAGGGTATGTATTACCTCGAGGAACACAGCATGGTGCATAGGGACCTTGCGCTCCGGAATGTGATGCTT
AAG
TCACCGAGTCAAGTCCAGGTGGCAGATTTTGGTGTGGCTGACTTGCTGCCGCCAGATGACAAGCAGT
TA
CTACACAGTGAGGCCAAGACTCCAATTAAATGGATGGCCCTTGAGAGTATCCACTTTGGGAAATACAC
A
CACCAGAGTGATGTCTGGAGTTACGGTGTAACCGTTTGGGAGTTGATGACCTTCGGGGCAGAGCCCTAC
GCA
GGGCTACGACTGGCTGAAATACCAGACCTGCTGGAGAAGGGAGAGCGGTTAGCACAGCCCCAGATCT
GC
ACCATTGACGTCTACATGGTCATGGTCAAGTGTTGGATGATTGACGAGAATATTCGCCCAACCTTTAA
A
GAACTGGCCAATGAGTTTACCAGGATGGCCCGGGACCCACCAAGGTATCTGGTCATCAAGAGAGCGAGT
GGG
CCTGGAATACCTCCTGCAGCAGAGCCATCTGCTCTGAGCACCAAAGAGTTGCAGGATGCAGAGCTGG
AG
CCAGACCTGGACCTCGACCTAGACGTGGAGGTAGAAGAGGAGGGCCTGGCGACCACACTGGGTTCTGC
C
CTCAGCTTGCCTACAGGAACGCTTACCCGGCCACGTGGGAGCCAGAGTCTTTTAAGTCCTTCGTCTGGA
TAC
ATGCCCATGAACCAGAGCAACCTTGGGGAGGCTTGTCTGGATTCTGCGGTTTTGGGGGGTCGCGAAC
AG
TTCTCCCGTCCCATCTCTCTGCACCCGATCCCACGGGGGCGTCAAACGTCAGAGTCATCAGAGGGCCA
T
GTGACGGGCTCTGAGGCTGAACTCCAAGAGAGAGTATCAATGTGTAGGAGCCGGAGCCGGAGCCGGAGC
CCA
CGGCCACGTGGGGACAGTGCCTACCATTCGCAGCGACACAGCCTGCTTACTCCCGTCACCCCGCTCT
CC
CCACCAGGGTTAGAGGAAGAGGATGGCAATGGTTATGTCATGCCAGATACGCACCTCAGAGGTACATC
C
TCTTCCCGGGAAGGCACCCTTTCGTCAGTAGGTCTCAGTTCTGTGCTGGGTACCGAAGAGGAAGATGAA
GAT
GAGGAGTATGAATACATGAACCGGAAGAGGAGGGGTAGCCCGGCTCGGCCCCCCAGACCTGGTTCCC
TG
GAAGAGCTGGGCTATGAGTACATGGATGTGGGTTCAGACCTCAGTGCTTCTCTGGGCAGTACGCAGAG
T
TGCCCACTCCATCCCATGGCCATCGTGCCCTCTGCTGGCACGACTCCAGATGAGGACTATGAATACATG
AAC
CGCAGGCGTGGTGCGGGCGGTTCCGGAGGGGATTATGCAGCTATGGGGGCCTGCCCAGCAGCTGAAC
AA
GGGTATGAGGAAATGCGAGCTTTCCAGGGGCCTGGACATCAAGCCCCCCATGTTCGTTATGCCCGCCT
C
AAAACTCTGCGTAGTTTAGAAGCCACTGACTCCGCCTTTGACAACCCCGATTACTGGCATAGCAGGCTT
TTC
CCTAAGGCTAACGCCCAGAGAATTTGA


Translation (1339 aa):
MSAIGTLQVLGFLLSLARGSEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTGH
N
ADLSFLQ
WIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRFTQLT
E
ILLGGVYIEKNDKLCHMDTIDWRDIVRVPDAEIVVKNNGGNCPPCHEVCKGRCWGPGPEDCQILTKTIC
A
PQCNGRCFGPNPNQCCHDECAGGCSGPQDTDCF
ACRHFNDSGACVPRCPAPLVYNKLTFQLEPNPHIKY
Q
YGGVCVASCP
HNFVVDQTFCVRACPADKMEVDKNGLKMCEPCRGLCPKACEGTGSGSRYQTVDSSNIDG
F
VNCTKILGNLDFLITGLN
GDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
R
SLY
NRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPAEERLDIKYNRPL
G
EC
VAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNVLQGEPREFVHEAHCFSCHPECQPME
G
TSTCNGS
GSDACARCAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQGCKGPELQDCL
G
QAEVLM
SKPHLVIAVTVGLTVIFLILGGSFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLAR
I
FKETELRKLKVLGSGVFGTVHK
GIWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAVGSLDHAHIV
R
LLGLCPGSSLQLVTQYLPLGSLLDHVRQHRETLGPQLLLNWGVQIAK
GMYYLEEHSMVHRDLALRNVML
K
SPSQVQVADFGVADLLPPDDKQLLHSEAK
TPIKWMALESIHFGKYTHQSDVWSYGVTVWELMTFGAEPY
A
GLRLAEIPDLLEKGERLAQPQICTIDVYMVMVK
CWMIDENIRPTFKELANEFTRMARDPPRYLVIKRAS
G
PGIPPAAEPSALSTKELQDAELEPDLDLDLDVEVEEEGLATTLGSALSLPTGTLTRPRG
SQSLLSPSSG
Y
MPMNQSNLGEACL
DSAVLGGREQFSRPISLHPIPRGRQTSESSEGHVTGSEAELQERVSMCRSRSRSRS
P
RPRGDSAYHSQRHSLLTPVTPLSPPGLEEEDGNGYVMPDTHLR
GTSSSREGTLSSVGLSSVLGTEEEDE
D
EEYEYMNRKRRGSPARPPRPGSLEELGYEYMDVGSDLSASLGSTQSCPLHPMAIVPSAGTTPDEDYEYM
N
RRRGAGGSGGDYAAMGACPAAEQGYEEMRAFQGPGHQAPHVRYARLKTLRSLEATDSAFDNPDYWHSRL
F
PKANAQRI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser