NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24156.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24156.1 Public Mus musculus 10 Slc6a15 16 104 75 CCDS HistoryNCBI Gene:103098Re-query CCDS DB by CCDS ID:24156.1Re-query CCDS DB by GeneID:103098

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24156.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000074204 ENSMUSP00000073829 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000074204Link to Ensembl Protein Viewer:ENSMUSP00000073829Re-query CCDS DB by Nucleotide ID:ENSMUST00000074204Re-query CCDS DB by Protein ID:ENSMUSP00000073829
Original member Current member EBI,WTSI ENSMUST00000179636 ENSMUSP00000136676 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000179636Link to Ensembl Protein Viewer:ENSMUSP00000136676Re-query CCDS DB by Nucleotide ID:ENSMUST00000179636Re-query CCDS DB by Protein ID:ENSMUSP00000136676
Original member Current member NCBI NM_001252330.1 NP_001239259.1 Accepted alive Link to Nucleotide Sequence:NM_001252330.1Link to Protein Sequence:NP_001239259.1Re-query CCDS DB by Nucleotide ID:NM_001252330Re-query CCDS DB by Protein ID:NP_001239259Link to BLink:NP_001239259.1
Original member Current member NCBI NM_175328.3 NP_780537.1 Accepted alive Link to Nucleotide Sequence:NM_175328.3Link to Protein Sequence:NP_780537.1Re-query CCDS DB by Nucleotide ID:NM_175328Re-query CCDS DB by Protein ID:NP_780537Link to BLink:NP_780537.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001239259.1 729 Q8BG16 729 100% 0 0
NP_780537.1 729 Q8BG16 729 100% 0 0

Chromosomal Locations for CCDS 24156.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

Chromosome Start Stop Links
10 103389053 103389341 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103393391 103393548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103393901 103394027 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103394990 103395171 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103400182 103400292 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103404285 103404526 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103404627 103404819 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103408203 103408395 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103409653 103409812 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103416633 103416795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 103418023 103418394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2190 nt):
ATGCCTAAGAATAGCAAAGTGGTAAAGAGAGATTTGGATGATGATGTCATTGAATCTGTCAAAGACCTCC
TG
TCCAACGAAGACTCAGTGGAAGAGGTTTCTAAGAAGAGTGAACTAATTGTCGATGTTCAGGAAGAGAA
A
GATACAGATGCTGAAGATGGATCTGAAGCTGATGATGAAAGGCCAGCCTGGAACAGTAAGCTGCAATAC
ATT
CTGGCCCAAGTTGGATTTTCTGTAGGTCTGGGGAATGTGTGGCGGTTCCCATACCTCTGCCAAAAGA
AT
GGTGGTGGTGCATATCTTTTGCCGTATTTAATACTACTTCTGGTGATAGGAATTCCACTCTTTTTCCT
G
GAACTTTCTGTGGGTCAAAGAATTCGAAGAGGCAGCATTGGGGTTTGGAATTACATAAGCCCTAAATTG
GGT
GGGATTGGCTTCGCAAGCTGTGTAGTGTGCTATTTTGTGGCTCTCTACTACAATGTCATCATTGGCT
GG
ACATTATTTTACTTTTCTCAGTCTTTTCAACAACCTCTTCCTTGGGATCAATGCCCCCTGGTGAAAAA
C
GCATCTCATACTTATGTTGAGCCAGAATGTGAACAAAGTTCTGCCACCACCTATTACTGGTACCGGGAA
GCA
CTGGATATCACCAGCTCCATCTCTGACAGTGGAGGCTTAAACTGGAAGATGACGGTCTGCCTTCTGG
TT
GCCTGGGTCATGGTTTGTCTGGCCATGATCAAAGGCATTCAGTCCTCTGGAAAAATCATGTATTTCAG
T
TCTCTGTTCCCCTACGTGGTCCTTATATGTTTCCTAATAAGATCTCTCCTTTTAAATGGTTCAATTGAT
GGC
ATCCGACACATGTTCACTCCTAAGCTGGAAATGATGTTGGAGCCCAAGGTTTGGAGAGAGGCAGCAA
CT
CAGGTGTTCTTTGCATTGGGTTTGGGATTTGGTGGAGTCATCGCGTTTTCAAGTTATAACAAGAGAGA
C
AACAACTGCCACTTCGATGCTGTCCTAGTGTCTTTCATCAACTTTTTCACTTCAGTTCTGGCAACACTG
GTG
GTGTTTGCAGTTCTGGGGTTCAAAGCCAATATCGTAAATGAAAAATGCATTTCACAAAACTCCGAGA
TG
ATCTTGAAACTTTTGAAAATGGGAAACATTAGTTGGGATGTCATTCCCCATCACATCAACCTCTCAGC
T
GTCACTGTGGAAGATTATCGTTTAGTTTACGACATCATTCAAAAAGTGAAGGAGGAGGAGTTTGCTGTT
CTT
CATCTCAACGCCTGTCAAATTGAGGATGAGCTAAATAAAGCTGTGCAGGGCACTGGCTTGGCTTTCA
TT
GCCTTTACAGAGGCCATGACACATTTCCCTGCATCTCCTTTCTGGTCAGTGATGTTTTTCCTCATGTT
G
ATAAATCTCGGCCTCGGCAGCATGTTTGGAACAATTGAAGGGATCATCACTCCTATTGTGGATACCTTC
AAA
GTGAGGAAGGAAATACTCACTGTTATCTGTTGCCTCCTGGCATTTTGTATTGGCTTGATATTCGTGC
AG
CGCTCTGGAAATTACTTCGTGACAATGTTTGACGATTATTCTGCTACATTGCCTCTGCTAATTGTGGT
C
ATCTTGGAGAATATTGCCGTGAGCTTTGTTTATGGCATAGATAAGTTTATAGAAGACCTCACAGACATG
TTA
GGATTTGCTCCAAGCAAATATTACTATTATATGTGGAAATACATTTCTCCTCTAATGCTACTAACGT
TG
CTAATAGCTAGCATTGTGAATATGGGATTAAGTCCTCCCGGATATAATGCATGGATCAAGGAGAAGGC
A
TCGGAAGAATTTCTGAGCTACCCGATGTGGGGGATGGTCGTCTGTTTCTCTCTGATGGTGCTGGCCATA
CTT
CCTGTCCCAGTGGTGTTCATCATTCGTCGCTGCAACCTCATAGATGATAGTTCTGGTAACTTGGCCT
CC
GTGACCTATAAGAGAGGAAGAGTCCTGAAGGAACCTGTGAACTTGGAAGGAGATGACGCAAGCCTCAT
T
CATGGAAAGATACCGAGTGAAATGTCATCTCCAAATTTTGGTAAAAATATTTATCGAAAACAAAGTGGT
TCC
CCAACACTGGATACTGCTCCCAATGGACGCTATGGGATTGGGTATTTGATGGCAGACATGCCAGATA
TG
CCAGAGTCTGACTTGTAG


Translation (729 aa):
MPKNSKVVKRDLDDDVIESVKDLLSNEDSVEEVSKKSELIVDVQEEKDTDAEDGSEADDERPAWNSKLQY
I
LAQVGFSVGLGNVWRFPYLCQKNGG
GAYLLPYLILLLVIGIPLFFLELSVGQRIRRGSIGVWNYISPKL
G
GIGFASCV
VCYFVALYYNVIIGWTLFYFSQSFQQPLPWDQCPLVKNASHTYVEPECEQSSATTYYWYRE
A
LDITSSISDSGGLNWKMTVCLLVAWVMVCLAMIKGIQSSGK
IMYFSSLFPYVVLICFLIRSLLLNGSID
G
IRHMFTPK
LEMMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATL
V
VFAVLGFKANIVNEKCIS
QNSEMILKLLKMGNISWDVIPHHINLSAVTVEDYRLVYDIIQKVKEEEFAV
L
HLNACQIEDELNK
AVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLINLGLGSMFGTIEGIITPIVDTF
K
VRKEILT
VICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILENIAVSFVYGIDKFIEDLTDM
L
GFAPSKYYYYMWKYISPLMLLTLLIASIVNMGLSPPGYNAWIKEK
ASEEFLSYPMWGMVVCFSLMVLAI
L
PVPVVFIIRRCNLIDDSSGNLASVTYKRGRVLKEPVNLEGDDASLIHGKIPSEMSSPNFGKNIYRKQSG
S
PTLDTAPNGRYGIGYLMADMPDMPESDL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser