NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24151.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24151.1 Public Mus musculus 10 4930430F08Rik 16 104 75 CCDS HistoryNCBI Gene:68281Re-query CCDS DB by CCDS ID:24151.1Re-query CCDS DB by GeneID:68281

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24151.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000054471 ENSMUSP00000062410 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000054471Link to Ensembl Protein Viewer:ENSMUSP00000062410Re-query CCDS DB by Nucleotide ID:ENSMUST00000054471Re-query CCDS DB by Protein ID:ENSMUSP00000062410
Original member Current member NCBI NM_175128.2 NP_780337.2 Accepted alive Link to Nucleotide Sequence:NM_175128.2Link to Protein Sequence:NP_780337.2Re-query CCDS DB by Nucleotide ID:NM_175128Re-query CCDS DB by Protein ID:NP_780337Link to BLink:NP_780337.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_780337.2 327 Q8BHN7-1 327 100% 0 0

Chromosomal Locations for CCDS 24151.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

Chromosome Start Stop Links
10 100573566 100573760 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100575717 100575886 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100577161 100577358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100578315 100578431 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100583914 100584009 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100586191 100586308 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100589027 100589116 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (984 nt):
ATGAAGCGCCTGGGCTCGGTGCAGCGGAAGATGCCGTGTGTGTTTGTGACGGAGGTGAAAGCTGAGCCTT
CA
GCCAAGCGGGAGCATCAGCCATTTAAAGTTTTGGCAACTGAAACTCTAAGTGAAAAGGCGTTAGATGC
A
GACGTGTACAATGCGGTTGCAACAGAAAAAGTGGATGGAACATGCTGCTATGTTACTAACTACAAAGGT
CAG
CCATACCTTTGGGCTCGACTAGATAGAAAACCTAACAAGCAGGCTGACAAGAGATTTAAAAAATTTC
TA
CATTCAAAAGAAAGTGCAAAAGAGTTTCACTGGAACACTGAGGAAGACTTCAAGCCTGTCCCAGAGTG
C
TGGATACCAGCAAAGGAAATAGAAAAACAAAACGGGAAGCCAGTGCCTGATGAAAACGGACACATCCCT
G
GT
TGGGTACCAGTAGAGAAGGGCAGCAAGCAATATTGCTGGCACTCGTCGGTAGTGAATTACGAGTTTG
GA
ATTGCCCTGGTACTAAGGCACCATCCTGATGATCCCGGGGTTTTGGAAATTAGTGCTGTTCCCCTGTC
A
GAGCTTTTAGAGCAAACCCTGGAGCTGATAGGCACGAGTATCAATGGAAACCCCTATGGGCTGGGAAGC
AAG
AAATCCCCGTTACATTTTCTCACACCACACGGAGCATTCCAGGTCAGAAATCTGCCCACACTGAAAC
AC
AATGACCTGCTGTCCTGGTTTGAAGACTGCAGAGAGGGTCAAATTGAAGGGATTGTGTGGCATTGCGG
T
GACGGCTGTTTAATTAAGGTCCATCGTCACCATCTTGGTTTATGCTGGCCACTTCCAGATACTTACATG
AAT
TCCAAACCAGTTATTATTAACATGAACCTGAACCTGAACAATTATGACTGTGCTTTTGATAACCAGT
CT
TTGTTTAATCAGTTTTCAAAAATAGATAAACAGAAATTTGAGAGACTCAAAGACATAATACTTGATGT
A
TAA


Translation (327 aa):
MKRLGSVQRKMPCVFVTEVKAEPSAKREHQPFKVLATETLSEKALDADVYNAVATEKVDGTCCYVTNYKG
Q
PYLWARLDRKPNKQADKRFKKFLHSKESAK
EFHWNTEEDFKPVPECWIPAKEIEKQNGKPVPDENGHIP
G
WVPVEKGSKQYCWHSSVVNYEFGIALVLRHHPDDPGVLEISAVPLSELLEQTLELIGTSINGNPYGLGS
K
KSPLHFLTPHGAFQVRNLPTLKHNDLLSWFEDCREGQIEGIVWHCGDGCLIK
VHRHHLGLCWPLPDTYM
N
SKPVIINMNLNLNNYDCAFDNQSLFNQFSKIDKQKFERLKDIILDV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser