NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23998.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23998.1 Public Mus musculus 10 Kiss1r 19 105 81 CCDS HistoryNCBI Gene:114229Re-query CCDS DB by CCDS ID:23998.1Re-query CCDS DB by GeneID:114229See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 23998.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000045529 ENSMUSP00000040516 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000045529Link to Ensembl Protein Viewer:ENSMUSP00000040516Re-query CCDS DB by Nucleotide ID:ENSMUST00000045529Re-query CCDS DB by Protein ID:ENSMUSP00000040516
Original member Current member NCBI NM_053244.5 NP_444474.1 Accepted alive Link to Nucleotide Sequence:NM_053244.5Link to Protein Sequence:NP_444474.1Re-query CCDS DB by Nucleotide ID:NM_053244Re-query CCDS DB by Protein ID:NP_444474Link to BLink:NP_444474.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_444474.1 396 Q91V45 396 100% 0 0

Chromosomal Locations for CCDS 23998.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 79918674 79918917 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 79919427 79919551 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 79920695 79920830 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 79921015 79921247 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 79921552 79922004 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1191 nt):
ATGGCCACCGAGGCGACATTGGCTCCCAATGTGACCTGGTGGGCTCCGTCCAACGCTTCAGGATGCCCAG
GC
TGCGGTGTCAACGCCTCGGATGACCCAGGCTCTGCGCCAAGGCCCCTGGATGCCTGGCTGGTTCCCCT
G
TTTTTCGCTACACTCATGTTGCTTGGGCTGGTCGGAAACTCATTGGTCATCTACGTTATCTGCCGCCAC
AAG
CACATGCAGACAGTTACCAACTTCTACATCGCTAACCTGGCTGCCACAGACGTCACTTTCCTACTGT
GC
TGCGTGCCCTTCACCGCACTCCTCTACCCGCTGCCCGCCTGGGTGCTGGGAGACTTCATGTGCAAATT
C
GTCAACTACATCCAGCAGGTCTCGGTGCAAGCCACATGTGCCACTCTGACGGCCATGAGTGTGGACCGC
TGG
TATGTGACTGTGTTCCCGCTGCGTGCACTTCACCGCCGCACTCCGCGCCTGGCCCTGGCTGTCAGCC
TC
AGCATCTGGGTGGGGTCAGCAGCTGTGTCCGCCCCGGTGCTGGCCCTGCACCGCCTGTCGCCAGGGCC
T
CGCACCTACTGCAGCGAGGCGTTTCCCAGCCGCGCCCTGGAGCGCGCCTTCGCGCTCTACAACCTGCTG
GCT
CTATATCTGCTGCCGCTGCTCGCCACCTGCGCCTGCTACGGCGCCATGCTGCGCCACCTGGGCCGTG
CG
GCTGTACGCCCCGCACCCACTGACGGCGCCCTGCAGGGACAGCTGCTAGCACAGCGCGCCGGAGCAGT
G
CGCACCAAGGTCTCCCGGCTGGTGGCCGCTGTCGTCCTGCTCTTCGCCGCCTGCTGGGGCCCGATCCAG
CTG
TTCCTGGTGCTTCAAGCCCTGGGCCCCTCGGGGGCCTGGCACCCTCGAAGCTATGCCGCCTACGCGG
TC
AAGATCTGGGCTCACTGCATGTCCTACAGCAACTCGGCGCTCAATCCGCTGCTCTATGCCTTCCTGGG
T
TCACACTTCAGACAGGCCTTCTGCCGCGTGTGCCCCTGCTGCCGGCAACGCCAGCGCCGGCCCCACACG
TCA
GCGCACTCGGACCGAGCTGCAACTCACACTGTGCCGCACAGCCGTGCTGCGCACCCTGTGCGGATCA
GG
AGCCCGGAGCCTGGGAACCCTGTGGTGCGCTCGCCCTGCGCTCAGAGTGAACGCACTGCCTCACTCTG
A


Translation (396 aa):
MATEATLAPNVTWWAPSNASGCPGCGVNASDDPGSAPRPLDAWLVPLFFATLMLLGLVGNSLVIYVICRH
K
HMQTVTNFYI
ANLAATDVTFLLCCVPFTALLYPLPAWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDR
W
YVTVFPLRALHRRTPRLALAVSLSIWV
GSAAVSAPVLALHRLSPGPRTYCSEAFPSRALERAFALYNLL
A
LYLLPLLATCACYGAMLRHLGRAAVRPAPTDGALQ
GQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQ
L
FLVLQALGPSGAWHPRSYAAYAVKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCCRQRQRRPHT
S
AHSDRAATHTVPHSRAAHPVRIRSPEPGNPVVRSPCAQSERTASL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser