NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22567.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22567.1 Public Mus musculus 8 Slc38a7 16 104 75 CCDS HistoryNCBI Gene:234595Re-query CCDS DB by CCDS ID:22567.1Re-query CCDS DB by GeneID:234595

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22567.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000040481 ENSMUSP00000037023 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000040481Link to Ensembl Protein Viewer:ENSMUSP00000037023Re-query CCDS DB by Nucleotide ID:ENSMUST00000040481Re-query CCDS DB by Protein ID:ENSMUSP00000037023
Original member Current member EBI,WTSI OTTMUST00000054070 OTTMUSP00000025752 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054070Link to Vega Protein Viewer:OTTMUSP00000025752Re-query CCDS DB by Nucleotide ID:OTTMUST00000054070Re-query CCDS DB by Protein ID:OTTMUSP00000025752
Original member Current member NCBI NM_172758.4 NP_766346.1 Accepted alive Link to Nucleotide Sequence:NM_172758.4Link to Protein Sequence:NP_766346.1Re-query CCDS DB by Nucleotide ID:NM_172758Re-query CCDS DB by Protein ID:NP_766346Link to BLink:NP_766346.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766346.1 463 Q8BWH0 463 100% 0 0

Chromosomal Locations for CCDS 22567.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

Chromosome Start Stop Links
8 95837569 95837671 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 95840414 95840468 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 95841522 95841721 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 95842176 95842323 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 95843760 95843874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 95844104 95844161 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 95844888 95844986 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 95845799 95845943 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 95846133 95846331 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 95848381 95848650 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1392 nt):
ATGGCCCAGGTCAGCATCAACAGTGACTACAGCGAGTGGGCTTCCAGCACTGATGCTGGGGAGCGGGCCC
GT
TTGCTCCAAAGTCCCTGTGTGGATGTGGTACCTAAGAGTGAGGGGGAGGCGTCTCCTGGAGATCCAGA
C
AGCGGCACCACTTCGACGCTTGGAGCCGTCTTCATCGTCGTCAATGCCTGCCTCGGTGCGGGTCTGCTC
AAC
TTCCCAGCAGCCTTCAGCACCGCTGGGGGCGTGGCAGCTGGCATCGCCCTGCAGATGGGCATGCTGG
TT
TTTATCATCAGTGGGCTGGTCATTCTGGCCTACTGCTCTCAAGCCAGCAATGAGAGGACCTACCAGGA
G
GTGGTGTGGGCCGTGTGTGGCAAGCTGACAGGTGTGCTGTGTGAGGTAGCCATTGCGGTCTATACCTTC
GGA
ACCTGCATCGCCTTCCTCATCATTATTGGGGACCAGCAGGACAAGATTATAGCTGTGATGTCGAAGG
AG
CCGGATGGGGCCAGCGGCAGCCCCTGGTACACAGACCGCAAGTTCACCATCAGTCTTACCGCCTTCCT
C
TTCATCCTGCCCCTGTCCATCCCCAAGGAGATTGGCTTCCAGAAATATGCCAGCTTCCTGAGCGTCGTG
GGC
ACCTGGTACGTCACCGCCATTATAATCATCAAATACATCTGGCCAGATAAAGAGATGCGCCCGGGGG
AC
ATCTTGACTAGACCAGCGTCCTGGATGGCTGTGTTCAACGCCATGCCCACCATCTGCTTTGGATTTCA
G
TGTCATGTGAGTAGTGTACCCGTCTTCAACAGCATGCGGCAGCCCGAAGTAAAGACCTGGGGCGGAGTG
GTG
ACGGCTGCCATGGTCATAGCTCTGGCTGTCTACATGGGCACAGGCATCTGTGGCTTCCTAACCTTTG
GA
GCTGCTGTGGACCCCGACGTGCTCCGGTCCTACCCCTCAGAGGACGTGGCTGTGGCCGTTGCCCGAGC
C
TTCATCATCCTGAGTGTGCTCACCTCCTATCCAATCTTGCACTTCTGTGGGCGGGCTGTGGTGGAAGGC
CTG
TGGCTGCGCTACAAGGGGATGCCCGTGGAGGAGGATGTGGGCCGGGAGCGCCGGCGCCGGGTCCTGC
AG
ACGCTGGTGTGGTTCCTGCTGACCTTGCTACTGGCGCTCTTTATCCCTGACATTGGCAAGGTCATCTC
G
GTCATCGGAGGCCTGGCAGCCTGCTTCATCTTCATCTTCCCAGGGCTGTGCCTCATTCAAGCCAAACTA
TCA
GAGATGGAGGAGGTCAAACCTGCCAGCTGGTGGGCACTGGTCAGTTACGGAGTCCTTCTGGTCACAT
TG
GGAGCCTTCATCTTCGGCCAGACCACAGCCAATGCCATTTTTGTGGATCTCTTGGCCTGA


Translation (463 aa):
MAQVSINSDYSEWASSTDAGERARLLQSPCVDVVPKSEGEASPGDPDSGTTSTLGAVFIVVNACLGAGLL
N
FPAAFSTAGGVAAGIALQM
GMLVFIISGLVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTF
G
TCIAFLIIIGDQQDK
IIAVMSKEPDGASGSPWYTDRKFTISLTAFLFILPLSIPKEIGFQKYASFLSVV
G
TWYVTAIIIIKYIWPDKEMRPGDILT
RPASWMAVFNAMPTICFGFQCHVSSVPVFNSMRQPEVKTWGGV
V
TAAMVIALAVYMGT
GICGFLTFGAAVDPDVLRSYPSEDVAVAVARAFIILSVLTSYPILHFCGRAVVEG
L
WLRYKGMPVEEDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACFIFIFP
GLCLIQAKL
S
EMEEVKPA
SWWALVSYGVLLVTLGAFIFGQTTANAIFVDLLA



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser