NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22333.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22333.1 Public Mus musculus 8 March1 16 104 75 CCDS HistoryNCBI Gene:72925Re-query CCDS DB by CCDS ID:22333.1Re-query CCDS DB by GeneID:72925

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 22333.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000072482 ENSMUSP00000072302 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000072482Link to Ensembl Protein Viewer:ENSMUSP00000072302Re-query CCDS DB by Nucleotide ID:ENSMUST00000072482Re-query CCDS DB by Protein ID:ENSMUSP00000072302
Original member Current member EBI,WTSI ENSMUST00000110259 ENSMUSP00000105888 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110259Link to Ensembl Protein Viewer:ENSMUSP00000105888Re-query CCDS DB by Nucleotide ID:ENSMUST00000110259Re-query CCDS DB by Protein ID:ENSMUSP00000105888
Original member Current member EBI,WTSI OTTMUST00000040269 OTTMUSP00000017990 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000040269Link to Vega Protein Viewer:OTTMUSP00000017990Re-query CCDS DB by Nucleotide ID:OTTMUST00000040269Re-query CCDS DB by Protein ID:OTTMUSP00000017990
Original member Current member NCBI NM_175188.4 NP_780397.2 Accepted alive Link to Nucleotide Sequence:NM_175188.4Link to Protein Sequence:NP_780397.2Re-query CCDS DB by Nucleotide ID:NM_175188Re-query CCDS DB by Protein ID:NP_780397Link to BLink:NP_780397.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_780397.2 285 Q6NZQ8-3 285 100% 0 0

Chromosomal Locations for CCDS 22333.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

Chromosome Start Stop Links
8 65967157 65967255 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 66276662 66276712 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 66386440 66386519 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 66418816 66418996 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 66456053 66456200 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 66468232 66468530 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (858 nt):
ATGCCCCTCCACCAGATTTCTGTAATCCCAGCCCGGGAGACAGCCAGCAATGGGAGAAGTTCAATGGGCA
GA
AACAAAGAGAAGAACAAGGAAGTTGAGAATGAAAAGTCCCCAGGGCGATCTGCAAGTCGATCAAGTAA
C
ATATCAAAAGCAAGCAGCCCAACGACAGGGACAGCTCCCAGGAGCCAGTCAAGGTTGTCTGTCTGTCCA
TCT
ACTCAGGACATCTGCAGGATCTGTCACTGCGAAGGAGATGAAGAGAGCCCACTCATCACACCCTGTC
GC
TGCACAGGAACCTTGCGCTTTGTCCACCAGTCCTGCCTCCACCAATGGATCAAGAGCTCAGACACACG
A
TGCTGTGAGCTCTGCAAGTATGACTTCATAATGGAGACCAAGCTCAAGCCCCTTCGGAAGTGGGAAAAG
CTC
CAGATGACCACGAGCGAAAGGAGGAAAATATTCTGCTCTGTCACGTTCCACGTCATCGCCGTCACCT
GT
GTGGTGTGGTCCTTGTATGTGTTGATAGATCGGACAGCGGAGGAAATCAAGCAAGGTAACGACAATGG
T
GTGCTGGAATGGCCATTTTGGACAAAACTGGTTGTGGTGGCTATTGGCTTCACGGGAGGTCTCGTCTTC
ATG
TATGTACAGTGTAAAGTCTACGTCCAACTGTGGCGCCGGCTGAAGGCCTACAACCGTGTGATCTTTG
TG
CAGAATTGCCCAGACACTGCCAACAAACTGGAGAAGAACTTCCCGTGTAATGTGAACACGGAAATCAA
G
GATGCTGTGGTTGTGCCTGTGCCACAGACAGGTTCAAATACACTGCCAACTGCAGAGGGAGCCCCACCT
GAG
GTTATACCAGTCTGA


Translation (285 aa):
MPLHQISVIPARETASNGRSSMGRNKEKNKEVENEKSPGRSASRSSNISKASSPTTGTAPRSQSRLSVCP
S
TQDIC
RICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETKLKPLRKWEK
L
QMTTSERRKIFCSVTFHVIAVTCVVWSLYVLIDRTAEEIKQGNDN
GVLEWPFWTKLVVVAIGFTGGLVF
M
YVQCKVYVQLWRRLKAYNRVIFVQNCPDTANKLEKNFPCNVNTEIKDAVVVPVPQTGSNTLPTAEGAPP
E
VIPV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser