NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21271.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21271.1 Public Mus musculus 7 Ccdc114 16 104 75 CCDS HistoryNCBI Gene:211535Re-query CCDS DB by CCDS ID:21271.1Re-query CCDS DB by GeneID:211535

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 21271.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000038720 ENSMUSP00000042772 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000038720Link to Ensembl Protein Viewer:ENSMUSP00000042772Re-query CCDS DB by Nucleotide ID:ENSMUST00000038720Re-query CCDS DB by Protein ID:ENSMUSP00000042772
Original member Current member EBI,WTSI OTTMUST00000067374 OTTMUSP00000033891 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000067374Link to Vega Protein Viewer:OTTMUSP00000033891Re-query CCDS DB by Nucleotide ID:OTTMUST00000067374Re-query CCDS DB by Protein ID:OTTMUSP00000033891
Original member Current member NCBI NM_001033243.2 NP_001028415.1 Accepted alive Link to Nucleotide Sequence:NM_001033243.2Link to Protein Sequence:NP_001028415.1Re-query CCDS DB by Nucleotide ID:NM_001033243Re-query CCDS DB by Protein ID:NP_001028415Link to BLink:NP_001028415.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028415.1 658 Q3UX62 658 100% 0 0

Chromosomal Locations for CCDS 21271.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

Chromosome Start Stop Links
7 45928562 45928623 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45929067 45929256 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45936271 45936393 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45936556 45936669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45939655 45939722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45941660 45941847 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45942059 45942193 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45942578 45942660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45942761 45942929 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45947383 45947546 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45947623 45947720 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45947982 45948060 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 45948141 45948644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1977 nt):
ATGATGGAGTTGGAAAGGCGGGCATACAGCAAGGAAGTTCATCAGCGCCTCAGGAAGCAAGTCGAGGAGA
TT
CGGCAGCTGGAGATGCTTCGAGCCAAGCTCCAGACGCAGATTAACGTAGCGCAGAGCCAGGTCAAGCG
A
CTGGGAGACAAGAAGCATTTGGCGGAAATGGAATGTCTTCTCAAGTCTCGGGCCCAGGTGCAGGTGGAA
ATC
GAGGCGCTGCAAGAGCAGAACCGGGCCCTGGACAAGCAGATCCAGGACTGGGAGACCCATGTCCTCA
CG
CAGAGTAAGGAGGCCTCGGCTCCCGATCTCATCATGTACCAGAAGATGAAAATCCAGAGAAGGATCAG
G
ATCCTTGAAGACCAGCTGGACAGGGTCACCTGTCATTTTGACATCCATCTGGTGAGGAATGCAGCCCTG
CGG
GAGGAGCTGGAGCTGCTGCGCATCGAGAGGGGCCGCTACCTGAATATGGACCGCAAGCTGAAGAAGG
AG
ATCCACCTACTCCGGGAGATGGTTGGAGCTCTCAGCACATCCTCTACTTCTGCTTATACTGCCAGGGA
A
GAGGCCAAGACCAAGATGGGCATGCTTCAGGAGCGCGCAGAGAAGGAGCTGGCTCAGAGTGATACGGAG
GCA
CAGATCTTGCTGCGACAGATATCGCATCTGGAGCAGCTGCATCGATTCCTTAAGCTCAAGAACGATG
AA
CGACAACCGGATCCCCGTGTGGTGCAAAAGGCAGAACAGCGAGACTGGGAAGTGTCAGAAGGACTCCG
A
AAGACCTCCCAAGAGAAGCTAGTGCTGCGTTATGAGGACACTCTGGGCAAACTGGCCCAGCTGACCGGC
GAG
AGCGACCCTGACCTTTTGGTGGAGAAATACCTGGAGTTGGAGGAACGCAACTTTGCTGAGTTTAACT
TC
ATCAATGAGCAGAACTCCGAGATACACCACCTTCAGGAGGAGATCAAAGAGATGCAGGAAGCCTTAGT
C
AGTGAGCATGCCAGTCAGGATAAACAGCGCATGCAGCAAGAGCAGCAGTGCAAAATGTTGCAGCAGGAT
GTG
GACAAGATGTGTTCTGAGTCAGAGCAGCTGGAGGGTCGCTTCCAGGTGCTCCGAGGTCAGCTGGAAA
AA
ATCAAGACTGATATCCAGGTGCTCTTCGACAAGGCTAAGTGTGACAGCAGTGTCATCAAGGATCTCCT
T
GGGGTCAAGACCTACATGCGGGACAGGGACATAGGCCTCTTCCTGAGTACCATTGAGAGGCGGCTGGTG
CAG
CTCCTCACTGTGCAGGCCTTCCTCCAGGTCCAGAACCTTGCCCCTTTGGCTGATGCTGCACTTCTAG
CA
CTGGGCCAGAGCCTACAGGAACCCTCCAAGAAGACGACTCCACTCAAGCCTCCTGATACCATGGAGGA
C
TCCTCAGGGGCTGTAATCAAAGAGGATTACCCTATGAGCAAGGAGGAGTTGCTAAGCCAAGTCATGAAG
TCG
CTGCAGCTCCAGGACGAGGAGGAGTCCGCCAAGAAGCTGGACAGCAGCCCGAGCTTGACTCTCTCCA
GT
CCACAGATCTCCCTGGTCACTGTCCCCAAGCATTCCAAGAAGACCAGTGTAGTCCCCGAATCCATCCT
G
AGCCACAAGACGAACCGAGGCCGTGGCACTGGCTCCGTGAGCCATGTCACCTTTGGTGACTCTGCCTCT
GCT
GCAGGCCCTGTGGCCATGGCTTCTGCCAGTGCCAGTGGAGCACCTGTGTCCAGTCGGAGCTCCCAGG
GG
GGCCGTGGGGGCTTCAAACCCACGAGCTCCAGCAGCTACCTGGGGTCTACAGGCTACCTAGAGACCAG
C
AGAGGCCGCGAGAGCACAGCAGGCGGCGTTCACAGCCAGAGCATGGGATCTGAGTTGAGTAGAGGCCTC
AGT
TCCAGCAGTGGCCATGCATCCAGTCCTGCCCCTCCCTCCAGGCCCAGCTCCTCTACTAGCAAGGACT
CC
AGGGGCTACAACTAG


Translation (658 aa):
MMELERRAYSKEVHQRLRKQVEEIRQLEMLRAKLQTQINVAQSQVKRLGDKKHLAEMECLLKSRAQVQVE
I
EALQEQNRALDKQ
IQDWETHVLTQSKEASAPDLIMYQKMKIQRRIRILEDQLDRVTCHFDIHLVRNAAL
R
EELELLRIERGRYLNMDRKLKK
EIHLLREMVGALSTSSTSAYTAREEAKTKMGMLQERAEKELAQSDTE
A
QILLRQISHLEQLHRFLKLKNDERQPDPRVVQKAEQR
DWEVSEGLRKTSQEKLVLRYEDTLGKLAQLTG
E
SDPDLLVEKYLE
LEERNFAEFNFINEQNSEIHHLQEEIKEMQEALVSEHASQDKQRMQQEQQCKMLQQD
V
DKMCSESEQLEGRFQVLRGQLEKIKT
DIQVLFDKAKCDSSVIKDLLGVKTYMRDRDIGLFLSTIERRLV
Q
LLTVQAFLQVQ
NLAPLADAALLALGQSLQEPSKKTTPLKPPDTMEDSSGAVIKEDYPMSKEELLSQVMK
S
LQLQDEEESAKKLDSSPSLTLSSPQISLVTVPKHSKKTSVVPESILSHKTNRGRGTGSVSHVTFGDSAS
A
AGPVAMASASASGAPVSSRSSQGGRGGFKPTSSSSYLGSTGYLETSRGRESTAGGVHSQSMGSELSRGL
S
SSSGHASSPAPPSRPSSSTSKDSRGYN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser