NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19999.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19999.1 Public Mus musculus 6 Cnot4 16 104 75 CCDS HistoryNCBI Gene:53621Re-query CCDS DB by CCDS ID:19999.1Re-query CCDS DB by GeneID:53621

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19999.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044163 ENSMUSP00000044137 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044163Link to Ensembl Protein Viewer:ENSMUSP00000044137Re-query CCDS DB by Nucleotide ID:ENSMUST00000044163Re-query CCDS DB by Protein ID:ENSMUSP00000044137
Original member Current member NCBI NM_016877.4 NP_058573.3 Accepted alive Link to Nucleotide Sequence:NM_016877.4Link to Protein Sequence:NP_058573.3Re-query CCDS DB by Nucleotide ID:NM_016877Re-query CCDS DB by Protein ID:NP_058573Link to BLink:NP_058573.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058573.3 575 Q8BT14-1 575 100% 0 0

Chromosomal Locations for CCDS 19999.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

Chromosome Start Stop Links
6 35046258 35046358 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 35051062 35051559 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 35052842 35053091 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 35056211 35056268 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 35064889 35065022 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 35068588 35068713 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 35069370 35069471 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 35070217 35070303 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 35077981 35078178 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 35079961 35080134 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1728 nt):
ATGTCTCGCAGTCCTGATGCAAAGGAAGACCCTGTGGAATGCCCTCTTTGCATGGAGCCCTTGGAAATAG
AT
GATATTAACTTTTTCCCTTGCACCTGTGGCTACCAGATATGCCGATTTTGTTGGCATCGAATTCGCAC
T
GATGAGAATGGGCTTTGTCCTGCATGTAGAAAACCATATCCAGAAGATCCAGCAGTTTACAAACCACTT
TCC
CAGGAAGAATTACAAAGGATAAAGAATGAGAAAAAACAGAAACAAAATGAAAGAAAACAGAAAATCT
CA
GAAAATAGAAAACATTTGGCTAGTGTACGTGTTGTACAAAAAAACCTTGTGTTTGTTGTAGGTCTGTC
A
CAGCGCCTAGCAGACCCAGAAGTTTTAAAACGACCAGAGTATTTTGGGAAGTTTGGTAAAATACATAAA
GTT
GTCATCAATAATAGCACATCCTATGCAGGCTCACAGGGTCCGAGTGCCAGTGCTTATGTAACGTATA
TC
CGGTCAGAAGATGCTCTCAGAGCAATACAGTGTGTCAACAATGTGGTAGTAGATGGCAGGACACTAAA
G
GCATCTTTAGGTACAACAAAGTACTGCAGTTATTTCTTAAAGAACATGCAGTGCCCAAAGCCTGACTGC
ATG
TATCTTCATGAATTGGGAGATGAGGCAGCCAGCTTCACAAAAGAGGAAATGCAGGCGGGTAAGCACC
AA
GAATATGAACAGAAGCTCCTCCAAGAATTATATAAATTAAATCCCAATTTTCTTCAGCTATCTACGGG
T
TCAGTTGATAAGAATAAGAACAAAGTGACACCATTACAAAGGTATGATACCCCCATTGACAAACCTTCA
GAT
TCTCTCAGTATAGGGAATGGTGATAATTCCCAACAGATATCTAACAGTGATACGCCTTCACCACCAC
CT
GGTTTATCAAAATCCAACCCTGTCATCCCCATCAGTTCATCCAATCACAGTGCGAGGTCTCCTTTTGA
A
GGGGCAGTAACAGAGTCACAGTCATTATTCTCAGACAATTTTCGCCACCCCAACCCTATACCAAGTGGG
CTT
CCTCCTTTTCCCAGCTCTCCACAGACACCCAGTGATTGGCCTACAGCTCCAGAACCACAGAGCCTCT
TC
ACATCAGAAACAATCCCAGTTTCATCATCTACAGACTGGCAAGCAGCATTCGGCTTTGGTTCTTCTAA
A
CAACCAGAGGATGACTTGGGGTTTGACCCCTTTGATGTCACTCGAAAAGCCTTAGCAGACCTGATTGAG
AAG
GAACTATCCGTCCAAGATCAACCTTCCCTTTCCCCCACATCTCTTCAGAACGCCTCCTCACACACTA
CG
ACCGCCAAAGGGCCAGGCTCTGGATTCCTGCACTCTGCTGCACCTACAAATGCCAACTCTCTCAATAG
T
ACCTTTTCAGTCTTGCCACAGAGGTTCCCTCAATTTCAGCAGCACCGAGCAGTTTATAATTCGTTCGGT
TTT
CCAGGCCAGGCAGCCCGCTATCCTTGGATGGCCTTTCCACGCAATAGCATCATGCACTTGAACCACA
CA
GCAAACCCCACCTCAAATAGTAATTTCTTGGACTTGAATCTCCCGCCACAGCACAACACAGGTCTGGG
A
GGGATCCCCATAGCAGGGGAAGAAGAGGTGAAGGTTTCGACCATGCCACTGTCCGCCTCTTCCCATTCA
TTA
CAACAAGGACAGCAGCCTACAAGTCTCCACACTACTGTGGCCTGA


Translation (575 aa):
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL
S
QEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPE
VLKRPEYFGKFGKIHK
V
VINNSTSYAGSQ
GPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDC
M
YLHELGDEAASFTKEEMQ
AGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPS
D
SLSIGNGDNSQQ
ISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSG
L
PPFPSSPQTPSDWPTAPEPQSLFTS
ETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIE
K
ELSVQDQPSLSPTSLQNASSHTTTAKGPGSGFLHSAAPTNANSLNSTFSVLPQRFPQFQQHRAVYNSFG
F
PGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPIA
GEEEVKVSTMPLSASSHS
L
QQGQQPTSLHTTVA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser