NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19672.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19672.1 Public Mus musculus 5 Ogfod2 16 104 75 CCDS HistoryNCBI Gene:66627Re-query CCDS DB by CCDS ID:19672.1Re-query CCDS DB by GeneID:66627

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19672.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000024470 ENSMUSP00000024470 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000024470Link to Ensembl Protein Viewer:ENSMUSP00000024470Re-query CCDS DB by Nucleotide ID:ENSMUST00000024470Re-query CCDS DB by Protein ID:ENSMUSP00000024470
Original member Current member EBI,WTSI OTTMUST00000071502 OTTMUSP00000036644 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000071502Link to Vega Protein Viewer:OTTMUSP00000036644Re-query CCDS DB by Nucleotide ID:OTTMUST00000071502Re-query CCDS DB by Protein ID:OTTMUSP00000036644
Original member Current member NCBI NM_025671.2 NP_079947.1 Accepted alive Link to Nucleotide Sequence:NM_025671.2Link to Protein Sequence:NP_079947.1Re-query CCDS DB by Nucleotide ID:NM_025671Re-query CCDS DB by Protein ID:NP_079947Link to BLink:NP_079947.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079947.1 349 Q9CQ04 349 100% 0 0

Chromosomal Locations for CCDS 19672.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

Chromosome Start Stop Links
5 124112338 124112466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 124112789 124112845 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 124113218 124113331 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 124113429 124113528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 124114065 124114192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 124114388 124114645 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 124114715 124114978 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1050 nt):
ATGGCGACTGCCGCCCAGCGGCGCTTCTGCCGCTGCGCCTGCTTCTGCTCCCAGAACCTGTACGTGGCGC
GC
TACGGGCTGCACCTGCGCTTCCGGGACGAGCATCAGCTGCGCCGTGACTACGGCCAGCTCCTGCGCAG
C
CGTGGTTGTGTCACCTCCAAGGACTTCCAGCAACTCTTGGAGGAGCTTGAGCAGGAGGTCGGGCGCCGC
CGC
AGGCTGGGACAGGAATCGGCTGTCAGGAAGGCTCTCATTGCCAGCTCCTACCACCCGGCTAGGCCTG
AG
GTCTACAGCTCACTGCAGGATGCTGCTCTGGCCCCCGAGTTTATGGCTGCAGCTGAATATAGTACGTC
C
CCAGGCGCAGATCTTGAGGGCCTTCTCCAGCGTCTGGAGACAGTGTCAGAGGAGAAGCGCATCTATCGG
GTG
CCAGTGTTCTCGGCCAAGTTCTGCCAGACCCTGCTGGAAGAGCTGGAGCATTTTGAGCAGTCGGACA
TG
CCCAAGGGAAGGCCCAACACCATGAACAACCATGGGGTACTGATGTATGAACTAGGCCTGGATGACCC
C
CTGGTGACCCCGCTGCGGGAACGCTTCCTGCTGCCACTGATGGCCTTGTTGTACCCAGACTACGGTGGG
GGC
TACCTCGACAGTCACCGTGCCTTTGTGGTCAAGTACGCACTGGGCCAGGACCTGGATCTGGGCTGTC
AC
TACGATAATGCTGAGCTTACCCTCAATGTGGCTCTGGGCAAGGACTTCACAGGGGGTGCCCTGTATTT
T
GGGGGCCTCTTCCAGGCACCCGCAGCCTTGAAGGAGACCCTGGAAGTGGAGCATGTGGTGGGCTCTGGT
ATC
CTGCACCGTGGCGGCCAGCTGCACGGGGCTCGGCCCCTGTGTAAGGGAGAGCGCTGGAACCTCGTCG
TG
TGGCTGCGGGCATCTGCTGTTCGAAATCGCCTCTGTCCCATGTGCTGCCAGAAGCCAGAGCTGGTGGA
C
GATGAGGGTTTCGGTGACGGCTTTACCCGGGAGGAGCCCACCACAGTGGATGTCTGTGTGTTGACTTGA


Translation (349 aa):
MATAAQRRFCRCACFCSQNLYVARYGLHLRFRDEHQLRRDYGQLLRSRGCVTSKDFQQLLEELEQEVGRR
R
RLGQESAVRKALIASSYHPARPEVYSSLQ
DAALAPEFMAAAEYSTSPGADLEGLLQRLETVSEEKRIYR
V
PVFSAKFCQTLLEELEHFEQSDMPKGRPNTMNNHG
VLMYELGLDDPLVTPLRERFLLPLMALLYPDYGG
G
YLDSHRAFVVKYALGQDLDLGCHYDNAELTLNVALGKDFTGGALYFGGLFQ
APAALKETLEVEHVVGSG
I
LHRGGQLHGARPLCKGERWNLVVWLRASAVRNRLCPMCCQKPELVDDEGFGDGFTREEPTTVDVCVLT




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser