NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19258.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19258.1 Public Mus musculus 5 Rab28 16 104 75 CCDS HistoryNCBI Gene:100972Re-query CCDS DB by CCDS ID:19258.1Re-query CCDS DB by GeneID:100972See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19258.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031011 ENSMUSP00000031011 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031011Link to Ensembl Protein Viewer:ENSMUSP00000031011Re-query CCDS DB by Nucleotide ID:ENSMUST00000031011Re-query CCDS DB by Protein ID:ENSMUSP00000031011
Original member Current member NCBI NM_027295.2 NP_081571.1 Accepted alive Link to Nucleotide Sequence:NM_027295.2Link to Protein Sequence:NP_081571.1Re-query CCDS DB by Nucleotide ID:NM_027295Re-query CCDS DB by Protein ID:NP_081571Link to BLink:NP_081571.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081571.1 221 Q99KL7 221 100% 0 0

Chromosomal Locations for CCDS 19258.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 41625770 41625862 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 41633173 41633250 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 41635806 41635909 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 41687721 41687850 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 41698390 41698478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 41703438 41703534 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 41707905 41707979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (666 nt):
ATGTCAGACTCTGAGGAGGAGAGCCAGGACCGGCAACTGAAAATCGTCGTGCTGGGGGACGGCACCTCGG
GG
AAGACCTCCTTAGCTACGTGTTTTGCTCAAGAGACATTTGGGAAGCAGTACAAGCAGACGATAGGACT
G
GATTTCTTTTTGAGAAGGATTACCTTACCAGGAAATTTGAATGTTACTCTTCAAGTTTGGGATATAGGA
GGG
CAGACAATAGGTGGCAAGATGTTGGATAAATACATCTATGGAGCACAGGGAATCCTCTTGGTATATG
AT
ATTACAAACTACCAAAGCTTTGAGAATTTGGAAGATTGGTATTCTGTGGTGAAGACAGTAAGTGAAGA
G
TCAGAAACTCAGCCCCTGGTTGCTTTAGTGGGCAATAAAATTGACTTGGAGCATATGCGAACAGTAAAA
GCT
GATAAGCACTTACGATTTTGCCAGGAAAATGGTTTTAGTAGCCACTTTGTTTCAGCCAAGACAGGAG
AC
TCTGTCTTCCTGTGTTTTCAGAAAGTTGCAGCAGAAATCCTGGGAATCAAATTAAACAAAGCAGAAAT
A
GAACAGTCACAGAGAGTGGTGAAGGCAGATATTGTAAACTACAACCAGGAGCCCTTGTCAAGAACTGTT
AAC
CCTCCTCGGAGCTCCATGTGTGCAGTGCAGTGA


Translation (221 aa):
MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNLNVTLQVWDIG
G
QTIGGKMLDKYIYGAQ
GILLVYDITNYQSFENLEDWYSVVKTVSEESETQPLVALVGNKIDLEHMRTVK
A
DKHLRFCQENGFSSHFVSAKTGDS
VFLCFQKVAAEILGIKLNKAEIEQSQRVVKADIVNYNQEPLSRTV
N
PPRSSMCAVQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser