NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18429.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18429.1 Public Mus musculus 4 Mrpl37 16 104 75 CCDS HistoryNCBI Gene:56280Re-query CCDS DB by CCDS ID:18429.1Re-query CCDS DB by GeneID:56280

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 18429.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000030365 ENSMUSP00000030365 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000030365Link to Ensembl Protein Viewer:ENSMUSP00000030365Re-query CCDS DB by Nucleotide ID:ENSMUST00000030365Re-query CCDS DB by Protein ID:ENSMUSP00000030365
Original member Current member EBI,WTSI OTTMUST00000019087 OTTMUSP00000008749 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000019087Link to Vega Protein Viewer:OTTMUSP00000008749Re-query CCDS DB by Nucleotide ID:OTTMUST00000019087Re-query CCDS DB by Protein ID:OTTMUSP00000008749
Original member Current member NCBI NM_025500.2 NP_079776.1 Accepted alive Link to Nucleotide Sequence:NM_025500.2Link to Protein Sequence:NP_079776.1Re-query CCDS DB by Nucleotide ID:NM_025500Re-query CCDS DB by Protein ID:NP_079776Link to BLink:NP_079776.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079776.1 423 Q921S7 423 100% 0 0

Chromosomal Locations for CCDS 18429.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 107056027 107056104 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 107057372 107057575 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 107060483 107060640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 107061883 107062068 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 107064385 107064500 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 107064587 107064770 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 107066450 107066795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1272 nt):
ATGGCCTTGGCGTCCGGGCCCGCTCTGCGGGCACTCGCTGGCTCTGGAAGGCTCGGCCTCGGAGGTTACG
GG
ACTCCGAAACGTGGGGCGTATGAGTGGGGCGTGCGCTCCACGCGGAAGCCCGAGCCTCGCCCCCTGGA
C
AGGGTGTACGAGATCCCCGGTCTGGAGCCCATTACCTACGAGGGCAAGAAGCACTTCGTCCCGTGGCTG
GCG
AGGCCGATCTTCCCGCCGTGGGAGCGCGGCTGGAATGACCCACGCTTCCACCGTGCCGCCCCGATCC
AC
GAACAGACTCTGTACAAGGAAGAACCCTGCTACATCTTCCACCAGCGTTGCCGACTCCTGGAGGGGAT
G
AAGCAGGCTCTCTGGCTTACTAAGACCAAGTTAATAGAAGGCCTCCCCAAGAAAGTGCTTAGTCTTGTT
GAT
GATCCAGCTAATCACATAGAGAACCAAGAACAGCGTGTTTTGGATATCATCTCCCATGCCCGGCTTT
GG
CACTCCACTGAGGACATCCCCAAGAGAGAGACTTACTGCCCACTCATTGTGGACAGCCTCATACAGCT
G
TGTAAATCCCAGATTCTCAAGCACCCTTCTCTAGCCAGGCGGACCTCTGCCCAAAACTGCACCTTAGCC
ACC
ACCTGGAACCGCGAGTCTCTTCTCCTTCAGGTCCGAGGTACTAGTAGTACCATACTGAGTGCCAAGG
AT
CCCCTGCCCGTCATTGCCTCCAGGGAGGAGGTTGAAGCTACCAGAAGTCATGTTCTTGAAACCTTCTA
T
CCCATATCTCCTACCATCGATCTTCAAGAATGCCACGTTTATGAAGTGAAAGATGACACAGGGTTCCAG
GAG
GGCTATCCTTACCCCCATCCCCACACCTTGTATTTCCTGGAAAAGGCCAATTTACGGCCACAACGCT
TT
CTTCCAGAACAACTAAGGGCTAAGATGCTCCTGTTTGCTTTCGCAAATGCCCTGGCCCAGGCCAGGCT
C
CTCTATGGGAACACAGCCAAAGTCTTGGAGCAGCCAATAGTCGTGCAGAGCGTGGGCACTGATGGCCGT
GTC
TTCCAGTTCCTGGTGCTGCAGTTGAACACCACAGATCTGGCTTCTAGCGAGGGCGTCAAGAATTTGG
TA
TGGACAGACTCAGACCAGCTCCTTTACCGGCACTTCTGGTGTCGCCCAGTCATCAAAAAAAAGGTGGT
G
GTGGAACCTGTTGGGCCTGTTGATTTCCAGCCGGAGACGTTCAGGAAGTTTTTAGCTCTGTACTTGCAT
GGT
GTTGTGTGA


Translation (423 aa):
MALASGPALRALAGSGRLGLGGYGTPKRGAYEWGVRSTRKPEPRPLDRVYEIPGLEPITYEGKKHFVPWL
A
RPIFPPWERGWNDPRFHRAAPIHEQTLYKEEPCYIFHQRCRLLE
GMKQALWLTKTKLIEGLPKKVLSLV
D
DPANHIENQEQRVLDIISHARLWHSTEDIPKRETY
CPLIVDSLIQLCKSQILKHPSLARRTSAQNCTLA
T
TWNR
ESLLLQVRGTSSTILSAKDPLPVIASREEVEATRSHVLETFYPISPTIDLQECHVYEVKDDTGFQ
E
GYPYPHPHTLYFLEKANLRPQRFLPEQLRAKMLLFAFANALAQARLLYG
NTAKVLEQPIVVQSVGTDGR
V
FQFLVLQLNTTDLASSEGVKNLVWTDSDQLLYRHFWCRPVIKKKVVV
EPVGPVDFQPETFRKFLALYLH
G
VV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser