NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17972.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17972.1 Public Mus musculus 4 Cdh17 16 104 75 CCDS HistoryNCBI Gene:12557Re-query CCDS DB by CCDS ID:17972.1Re-query CCDS DB by GeneID:12557

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 17972.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029871 ENSMUSP00000029871 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029871Link to Ensembl Protein Viewer:ENSMUSP00000029871Re-query CCDS DB by Nucleotide ID:ENSMUST00000029871Re-query CCDS DB by Protein ID:ENSMUSP00000029871
Original member Current member EBI,WTSI OTTMUST00000010244 OTTMUSP00000004872 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000010244Link to Vega Protein Viewer:OTTMUSP00000004872Re-query CCDS DB by Nucleotide ID:OTTMUST00000010244Re-query CCDS DB by Protein ID:OTTMUSP00000004872
Original member Current member NCBI NM_019753.4 NP_062727.1 Accepted alive Link to Nucleotide Sequence:NM_019753.4Link to Protein Sequence:NP_062727.1Re-query CCDS DB by Nucleotide ID:NM_019753Re-query CCDS DB by Protein ID:NP_062727Link to BLink:NP_062727.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062727.1 827 Q9R100 827 100% 0 0

Chromosomal Locations for CCDS 17972.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

Chromosome Start Stop Links
4 11767756 11767803 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11771268 11771366 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11780092 11780226 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11781151 11781289 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11783082 11783240 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11783336 11783535 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11784626 11784757 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11785122 11785272 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11795485 11795700 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11797695 11797771 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11799561 11799752 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11803877 11804121 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11807430 11807560 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11810235 11810474 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11814611 11814727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11814857 11814970 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 11816986 11817074 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2484 nt):
ATGGTGTCTGCCCAGCTTCACTTCCTGTGTCTTCTCACACTTTATTTGACCTGTGGATATGGCGAAGAAG
GG
AAGTTCAGCGGTCCCCTGAAGCCCATGACATTCTCCATTTTTGAAGGCCAAGAACCGAGTCAAGTCAT
A
TTCCAGTTTAAGACCAACCCTCCAGCTGTGACTTTCGAGCTAACGGGAGAGACAGATGGTATATTTAAG
ATA
GAAAAGGATGGACTTCTGTATCACACAAGAGCCCTGGACAGAGAAACAAGAGCGGTTCATCATCTGC
AG
CTTGCAGCCTTGGATTCTCATGGAGCTATAGTGGACGGTCCAGTCCCCATCACCATAGAAGTCAAGGA
C
ATCAATGACAACCGACCCACGTTTCTCCAGTCAAAATATGAAGGCTCAGTGAGGCAGAACTCTCGCCCA
G
GA
AAGCCTTTCATGTATGTCAATGCTACAGATCTGGATGATCCGGCTACTCCCAATGGCCAGCTTTTTT
AT
CAAATTGTCATCCAACTTCCCCAAATCAACGATGTTATGTACTTTCAAATCGACAGCAAAACAGGGGC
A
ATATCGCTTACCCCAGAAGGATCCCAGGAATTGGATCCAGTGAAGAATCCTTCCTACAACCTGGTGGTC
TCG
GTGAAGGACATGGGGGGCCAGAGTGAGAATTCCTTCAGTGATACTACATATGTAGATATTTCTATTA
GA
GAGAATATCTGGAAAGCACCAGAACCCGTGGAGATTAGAGAAAACTCGACTGATCCTCACCCCATCAA
A
ATCACTCAGGTGCAGTGGAATGACCCAGGGGCCCAGTATTCCTTAGTCAACAAGGAGAAGCTGTCGCCG
TTC
CCATTCTCGATCGACCAAGAAGGAAATATTTATGTGACTCAGGCCTTGGACCGGGAGGAAAAGAACT
CA
CATGTTTTCTTTGCAACTGCCAAGGATGAGAATGGAAAACCACTTGCATATCCACTGGAAATTTATGT
G
AAAGTTATTGACATTAATGACAACCCACCGACATGTCTGTCTCCAGTGACTGTATTTGAAGTCCAGGAG
AAT
GAACCATTGGGTAACAGCATCGGGATCTTTGAGGCCCATGATATGGACGAAGCTAACAACATCAACA
GT
ATTTTGAAATACAAGCTTGTAGACCAAACACCCAAAGTTCCCTCAGATGGACTTTTTCTCATTGGTGA
A
TATGAGGGAAAGGTTCAGTTAAGTAAACAGTCCTTGAAGAAGCAAGACAGTCCTCAGTACAACTTAAGT
ATC
GAGGTGTCTGACGTAGATTTCAAGACTCTCTGTTATATTCAAGTCAACGTTATTGATATCAATGATC
AG
ATTCCCATCTTTGAAACATCAAATTATGGAAGCAAGACTCTGTCTGAAGACACCGCCATCGGATCCAC
C
ATCCTAATCATCCAAGCTACAGATGCTGATGAGCCCTTTACAGGGAGCTCTAAAATCCTGTACAAGATT
GTA
CAGGGAGACACGGAGGGAAGACTAGAAGTTGTCACAGATCCCACGACCAATGCAGGATATGTCAAGA
TC
AAAAAGCCTCTTGATTTTGAAACTCAACCAGTTAGCAGCATTGTGTTCCAAGCGGAAAATCCTGAGCC
A
CTGGTGAAAGGCATAGAGTACAATGCTAGTTCTTTTGCCTCCTTCGAGCTGATTGTGACGGATGTGAAT
GAA
GTGCCTGTGTTCCCCCAGCGAATATTCCAAGCAAACGTCAGCGAGGATGCTGCTGTGGGCAGTAGAG
TG
GGCAACGTGACTGCCAGGGATCCTGAAGGCCTGACTGTGAGTTATTCACTGAAAGGCAATATGAGAGG
C
TGGCTTAAAATCGACTCTGTCACTGGTGAGATATTTAGTGCTGCTCCGCTGGATAGGGAAACAGAAAGT
GTG
TATCGAGTACAAGTGGTGGCCACTGAAGTAGGTGGGTCCTCTCTGAGTTCTACGGCAGATTTCCACC
TG
GTCCTCACAGATGTGAATGACAACCCCCCTCGCCTAGCTAAGGACTACACAGGCTTGTTCTTCTGCCA
T
CCCCTCAGTGCCCCTGGGAGCCTCATCTTTGAGGTCACTGACGATGACCAGCAGTCACTTCGGAGGCCC
AAG
TTTACATTCGCCCTTGGCAGAGAAGGCTTACAAAGTGACTGGGAAGTTTCAAAAATCAATGGTACAC
AT
GCTAGACTCTCCACCAGGCACACACGCTTTGAGGAACAAGTTTATAACATTCCAATCCGCATCAATGA
T
GGGGGGCAGCCACCCATGGAAGGGACTGTCTTCTTACCAGTTACTTTCTGCCAGTGTGTGGAAGGAAGC
TGT
TTCCGGCCAGCAGGCAGACAGGATGGGATACCCACTGTGGGCATGGCAGTTGGTATACTTCTGACCA
CA
TTTCTGGTCATTGGTATAATTTTAGCAGTTGTCTTCATCCGCATGAGGAAAGATAAAGTTGAAAATCC
G
CAGTCCCCTGAGAATAAGCCTCTGAGAAGCTGA


Translation (827 aa):
MVSAQLHFLCLLTLYLTCGYGEEGKFSGPLKPMTFSIFEGQEPSQVIFQFKTNPPAVTFELTGETDGIFK
I
EKDGLLYHTRALDRETRAVHHLQ
LAALDSHGAIVDGPVPITIEVKDINDNRPTFLQSKYEGSVRQNSRP
G
KPFMYVNATDLDDPATPNGQLFYQIVIQLPQINDVMYFQIDSKTGAISLTPEGSQELDPVKNPSYNLVV
S
VKDMGGQSENSFSDTTYVDISIRENIWKAPEPVEIRENSTDPHPIKITQ
VQWNDPGAQYSLVNKEKLSP
F
PFSIDQEGNIYVTQALDREEKNS
HVFFATAKDENGKPLAYPLEIYVKVIDINDNPPTCLSPVTVFEVQE
N
EPL
GNSIGIFEAHDMDEANNINSILKYKLVDQTPKVPSDGLFLIGEYEGKVQLSKQSLKKQDSPQYNLS
I
EVSDV
DFKTLCYIQVNVIDINDQIPIFETSNYGSKTLSEDTAIGSTILIIQATDADEPFTGSSKILYKI
V
QGDTEGRLEVVTDPTTNAGYVKIKK
PLDFETQPVSSIVFQAENPEPLVKGIEYNASSFASFELIVTDVN
E
VPVFPQRIFQANVSEDAAVGSRVGNVTARDPEGLTV
SYSLKGNMRGWLKIDSVTGEIFSAAPLDRETES
V
YRVQVVATEV
GGSSLSSTADFHLVLTDVNDNPPRLAKDYTGLFFCHPLSAPGSLIFEVTDDDQQSLRRP
K
FTFALGREGLQSDWEVSKIN
GTHARLSTRHTRFEEQVYNIPIRINDGGQPPMEGTVFLPVTFCQCVEGS
C
FRPAGRQDGIPTVGMAVGILLTTFLVI
GIILAVVFIRMRKDKVENPQSPENKPLRS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser