NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17684.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17684.1 Public Mus musculus 3 Mab21l3 16 104 75 CCDS HistoryNCBI Gene:242125Re-query CCDS DB by CCDS ID:17684.1Re-query CCDS DB by GeneID:242125

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 17684.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000061831 ENSMUSP00000059212 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000061831Link to Ensembl Protein Viewer:ENSMUSP00000059212Re-query CCDS DB by Nucleotide ID:ENSMUST00000061831Re-query CCDS DB by Protein ID:ENSMUSP00000059212
Original member Current member EBI,WTSI ENSMUST00000118411 ENSMUSP00000112730 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000118411Link to Ensembl Protein Viewer:ENSMUSP00000112730Re-query CCDS DB by Nucleotide ID:ENSMUST00000118411Re-query CCDS DB by Protein ID:ENSMUSP00000112730
Original member Current member EBI,WTSI OTTMUST00000065896 OTTMUSP00000032902 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065896Link to Vega Protein Viewer:OTTMUSP00000032902Re-query CCDS DB by Nucleotide ID:OTTMUST00000065896Re-query CCDS DB by Protein ID:OTTMUSP00000032902
Original member Current member EBI,WTSI OTTMUST00000065897 OTTMUSP00000032903 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065897Link to Vega Protein Viewer:OTTMUSP00000032903Re-query CCDS DB by Nucleotide ID:OTTMUST00000065897Re-query CCDS DB by Protein ID:OTTMUSP00000032903
Original member Current member NCBI NM_172295.4 NP_758499.3 Accepted alive Link to Nucleotide Sequence:NM_172295.4Link to Protein Sequence:NP_758499.3Re-query CCDS DB by Nucleotide ID:NM_172295Re-query CCDS DB by Protein ID:NP_758499Link to BLink:NP_758499.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_758499.3 429 Q8CI17 429 100% 0 0

Chromosomal Locations for CCDS 17684.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

Chromosome Start Stop Links
3 101815019 101815252 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101818623 101818817 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101819366 101819544 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101823240 101823531 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101826731 101826871 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 101834994 101835242 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1290 nt):
ATGGCAGATGAATTCTTCCATGCTGGAAAGGAAAACTGCAGTGAGCAGGCAAGAAGAAGTCAAGTCTCTG
GT
CCACGTTCACAATTCCAGAGAAGTTTTATCCAGAGAGTAACGTTGCTGGGAAAGCTACCCACCAGATT
T
GTCCTCCATCGGGAAAGAAAGCAGAAGGTTGCTGCTATACTGGGGGTTGACCAAGAAGCCATGAAGTCT
CTT
CCAGAGGGAGACTTAGACCATTGCCTGCTGAGCAAGGTGGACCTGAGGCGGCAGCAGATTTCTCAGA
CC
ATGGAGGAGGTGCAGAAAATCATCCACCTGCTAACCACAGAAATCAGCCGCCAGGACAGTCGTTTCGA
A
GCCGTGCCTGTCTCTGACACACACAACGAGAGCATTAAGGTTTTGGCCCCCAGCCTCTTCCATGTCACC
GTC
CCACTGAAAGGCCTTGCAGGGTACAAGGGGGTCCAGAGGCAGCGCTGGCGGTACTACAATGTGCAGG
GC
GCCAAGCTCACCTGCCCTCTGCGGGACCCCGAAGGCCTGCAACAGTGGCTGGAGACTGAGATGTTCAT
G
AAGACCCTGTGGCAGTGGCACAAGGCAGATGTGAACATTGAGGGGGACATTGTGCCAGCCAAAGTCCTG
CAG
GTGTTCCGGACGCTGGTGGAAAATGCAGTGAGAACCTGTCACCTCTCAGGCAAAGTCACTGTGCTAG
AA
AAACGCACTACGGTTTGGGTTGCCATGGAAACGTCCACAGGCCAGGTGGAGCTGGAGCTGGCCCCCAC
C
GTGGAGATCCCCACCACCTGGCCTGAGAAAGCCCAGTGGCCTCGGTGTCTGAAGCGATGGCCTTCCCCA
GAG
AGAGTGGAGTGCATCAAGTCCTTTGGGTTTAACTTGGTGGCCCAGTCCGCCTATCACTGGCAGCTGA
GT
TTCTCCCAGGCAGAGCAGGTGCTGTTTGAGCAGCTGGACGAGGATGGAGGCTGCCGCAGGCAATGCTT
T
CAGGTCCTGAGGCAGCTGAAGGAGGATGTGTGGTGTCCAGGGAGGAGGCCAGTCATCACCACCCACCAC
CTG
CAGACCGTGCTCTTCTGGACTTGTGAGAAATACCCCCACCTCAAGGATTGGCAGGTCTTCCATCAAG
CC
CTCCTGCGCCTCGTCCGGAAGCTGCACAGGTGTGTGAGCCAGCACTTCCTGAAGCACTATTTTGTTCC
A
AAGAGCAACCTCCTTCAGTCAGCTAACCCAAGCGAGCTGGATGCGGTGGCCCAGAAAGTGGCCTTTTTC
CTA
AAGAACCCGCAGGTTGAGCTGCCCTGA


Translation (429 aa):
MADEFFHAGKENCSEQARRSQVSGPRSQFQRSFIQRVTLLGKLPTRFVLHRERKQKVAAILGVDQEAMKS
L
PEGDLDHCLLSK
VDLRRQQISQTMEEVQKIIHLLTTEISRQDSRFEAVPVSDTHNESIKVLAPSLFHVT
V
PLKGLAGYKGVQRQRWRYYNVQGAKLTCPLRDPEGLQQWLETEMFMKTLWQWHKADVNIEGDIVPAKVL
Q
VFRTLVENAVRTCHLS
GKVTVLEKRTTVWVAMETSTGQVELELAPTVEIPTTWPEKAQWPRCLKRWPSP
E
RVECIK
SFGFNLVAQSAYHWQLSFSQAEQVLFEQLDEDGGCRRQCFQVLRQLKEDVWCPGRRPVITTHH
L
Q
TVLFWTCEKYPHLKDWQVFHQALLRLVRKLHRCVSQHFLKHYFVPKSNLLQSANPSELDAVAQKVAFF
L
KNPQVELP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser