NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16492.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16492.1 Public Mus musculus 2 Depdc7 16 104 75 CCDS HistoryNCBI Gene:211896Re-query CCDS DB by CCDS ID:16492.1Re-query CCDS DB by GeneID:211896

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16492.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028595 ENSMUSP00000028595 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028595Link to Ensembl Protein Viewer:ENSMUSP00000028595Re-query CCDS DB by Nucleotide ID:ENSMUST00000028595Re-query CCDS DB by Protein ID:ENSMUSP00000028595
Original member Current member EBI,WTSI OTTMUST00000035524 OTTMUSP00000015906 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035524Link to Vega Protein Viewer:OTTMUSP00000015906Re-query CCDS DB by Nucleotide ID:OTTMUST00000035524Re-query CCDS DB by Protein ID:OTTMUSP00000015906
Original member Current member NCBI NM_144804.1 NP_659053.1 Accepted alive Link to Nucleotide Sequence:NM_144804.1Link to Protein Sequence:NP_659053.1Re-query CCDS DB by Nucleotide ID:NM_144804Re-query CCDS DB by Protein ID:NP_659053Link to BLink:NP_659053.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_659053.1 511 Q91WS7 511 100% 0 0

Chromosomal Locations for CCDS 16492.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 104721925 104722118 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 104722876 104722954 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 104723039 104723164 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 104723308 104723450 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 104724570 104724781 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 104727122 104727311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 104728083 104728210 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 104730184 104730574 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 104742682 104742754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1536 nt):
ATGGCCACGGTTCGAGAGAAGGCGGCGGCGCTGAACCTGTCGGCTCTGCACAGCCCTGCACAGAGACCTC
CG
GGTTTCAGTGTGGCCCAGAAGCCATTCGGAGCCACGTACGTGTGGAGCAGCATTATAAACACCCTTCA
A
ACCCAGGTGGAAGTGAAGAAGCGAAGGCACCACTTAAAACGGCACAACGACTGCTTCGTCGGCTCGGAA
GCC
GTGGATGTCATTTACTCCCACTTAACTCAGAATAAATTCTTTGGTGATGTCGATATTCCTCGGGCCA
AA
GTGGTGCGAGTGTGTCAGGCACTTATGGACTACAAAGTATTTGAAGCCGTTCAAACTAGAGTCTTTGG
A
AAGGACAAGAAGCCTACATTTGAAGATAGCAGTTGCAGCCTTTATAGATTCACAACAATACCTAATCAG
GAT
AATCAGTTAGGCCATGAGAACAAAGTGCATTCGCCTTCCAGGTACTCAGATGCATCGTTTATGTCAT
CT
GATATCAAGTCGGACAGTTTGGAGGACCTGTGGGAGAACCTGAGTCTAAAGCCTGCCAGCTCCCCTCA
C
ATACATATCTCTACCAGGCTCTCTCCTCAAGTTATCAATGAAGTATGGCAAGAGGAGACGATTGGACGG
CTG
CTACAACTTGTCGACCTTCCATTTCTTGACTCCTTACTCAAACAGCAAGAGGTCGTACCTAAAGCCC
CT
CAGTCTAAGAGACAGCCTGACATGGTCAACACCAGCAACTATCTGGATCGAGGAATTCTCAGGGCCTA
T
GGTGACTCTCAGGAAGATGAATGGATCTCTGCAGCCATCGACTGCTTGGAATACCTTCCCGACCAGATG
GTT
GTGGATATAAGCAGGAACTTTCCTGAGCAACCAGACAGAACAGACTTAGTGAAGGAACTTCTGTTTG
AC
GCTATTGGCAGATATTATAGTACTAGGGAGCCTCTGTTGAACCACCTGTATGATGTTCATAATGGGAT
A
GCAGAGCTCCTGGTAAATGGGAAGACGGAAATGGCGTTAGAAGCCACGCAGCTGTTTCTGAAGCTTCAG
GAC
TCCCAGAACAGGGAGGAGTTTAGACGGCTGCTTTACTTCATGGCTGTTGCAGCAGATCCTTCGGAAT
TT
AAATTACAGGAAGAAAGTGACAATCGGATGGTAGTGAAAAGGGTATTCTCAAAAGCTATCGTCAACAA
T
AAAAATGTATCCAAAGGCAAAACCGATCTTCTTGTGCTCTTCTTAATGGATCACCAAAAAGATGTTTTC
AAG
ATTCCTGCAGCTCTACATAAAATTGTTAGTGTTAAGCTTCTGGCCATACAAAAAGGAAGAGATCCTA
AT
AAAGACACAGGCTATATTTATTGCCAGAGAATTGATGAAAGTGAGTATTCTAGCAGTACAAAGAAGAA
A
ACCAAAGATCAACTGTTGAGCTTACTAAAGACTATTGATGAGGATTCAAAACTCTCTGCCAAAGAGAAG
AAG
AAACTGCTAGGCCAATTTCGTAAGACTCACCCAGACATCTTCACTGAGTATTTTGGAGACTGA


Translation (511 aa):
MATVREKAAALNLSALHSPAQRPPGFSVAQKPFGATYVWSSIINTLQTQVEVKKRRHHLKRHNDCFVGSE
A
VDVIYSHLTQNKFFGDVDIPRAKVVRVCQALMDYKVFEAVQTRVFGKDKKPTFEDSSCSLYRFTTIPNQ
D
NQLGHENKVHSPS
RYSDASFMSSDIKSDSLEDLWENLSLKPASSPHIHISTRLSPQVINEVWQEETIGR
L
LQLVDLPFLDSLLKQQEVVPKAPQSKRQPDMVNTSNYLDRGILRAYGDS
QEDEWISAAIDCLEYLPDQM
V
VDISRNFPEQPDRTDLVKELLFDAIGRYYSTREPLLNHLYDVHNGIAELL
VNGKTEMALEATQLFLKLQ
D
SQNREEFRRLLYFMAVAADPSEFKLQEE
SDNRMVVKRVFSKAIVNNKNVSKGKTDLLVLFLMDHQKDVF
K
IPAALHKIVSVKLLAIQKGRDPNKDTGYIYCQRIDESEYSSSTKKKTKDQLLSLLKTIDEDSKLSAKEK
K
KLLGQFRKTHPDIFTEYFGD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser