NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16428.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16428.1 Public Mus musculus 2 Ddb2 16 104 75 CCDS HistoryNCBI Gene:107986Re-query CCDS DB by CCDS ID:16428.1Re-query CCDS DB by GeneID:107986

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16428.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028696 ENSMUSP00000028696 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028696Link to Ensembl Protein Viewer:ENSMUSP00000028696Re-query CCDS DB by Nucleotide ID:ENSMUST00000028696Re-query CCDS DB by Protein ID:ENSMUSP00000028696
Original member Current member EBI,WTSI OTTMUST00000034162 OTTMUSP00000015309 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000034162Link to Vega Protein Viewer:OTTMUSP00000015309Re-query CCDS DB by Nucleotide ID:OTTMUST00000034162Re-query CCDS DB by Protein ID:OTTMUSP00000015309
Original member Current member NCBI NM_028119.5 NP_082395.2 Accepted alive Link to Nucleotide Sequence:NM_028119.5Link to Protein Sequence:NP_082395.2Re-query CCDS DB by Nucleotide ID:NM_028119Re-query CCDS DB by Protein ID:NP_082395Link to BLink:NP_082395.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082395.2 432 Q99J79 432 100% 0 0

Chromosomal Locations for CCDS 16428.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 91211948 91212012 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 91212280 91212325 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 91212450 91212614 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 91216666 91216808 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 91217053 91217230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 91217307 91217406 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 91218744 91218889 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 91234108 91234299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 91234815 91234951 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 91236690 91236816 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1299 nt):
ATGGCTCCCAAGAAATGCCCAGAAACCCAGAAGTCCCCCGACGTTGCGGTGCTCCTCAGGAGCAAAAGTC
GC
AGAGGTCCTCAGGAGCTGGAGCCCGAAGCCAAGAAGCTGCGTGTGCAGGGTCCCGTTTCTAGCAGGAC
A
TGTGAGTCGTGCTGCCTTCTGGCAGAGTTGTCCAGCCTGCAGATCCCTTCACGGAGTAGCAGCATTGTC
AGG
GATCTTTACCAGCATAAGTTGGGCAAAGCCACCTGGTCATCACTACAGCAGGGTCTGCAGAAGTCCT
TT
TTGCACTCTCTAGCTTCTTACCAGGTATTCCGAAAAGCTGCCCCCTTTGACAGGAGGACTACGTCCTT
G
GCATGGCACCCGACTCATCCCAGTACCCTGGCTGTGGGCTCCAAAGGGGGAGATATTATGATCTGGAAC
TTT
GGCATCAAGGACAAACCTATCTTCCTTAAAGGGATTGGAGCTGGAGGAAGCATCACTGGGCTGAAGT
TT
AACCATCTCAATACCAACCAGTTTTTTGCCTCCTCAATGGAGGGAACAACCAGGCTGCAGGATTTTAA
A
GGCAACATTCTCAGAGTTTATACCAGCTCAAACTCTTGCAAGGTCTGGTTTTGCAGCCTTGATGTTTCT
GCC
AAGAGCAGAGTGGTGGTTACAGGAGACAATATGGGACATGTGATCCTGTTGAGCACAGATGGCAAGG
AG
CTTTGGAACCTCCGAATGCACAAGAAGAAAGTAGCCCACGTGGCCCTGAATCCCTGCTGTGATTGGCT
T
CTGGCCACAGCCTCCATAGATCAAACAGTGAAGATTTGGGACCTGCGCCAAATTAAAGGGAAAGACAGC
TTC
CTCTACTCACTGCCTCACAGGCATCCTGTCAATGCAGCTTGTTTTAGCCCAGATGGAGCTCGGCTCC
TG
ACTACTGACCAGAACAATGAGATTCGGGTTTACTCTGCCTCCCAGTGGGATAGCCCCCTGAATCTGAT
C
TCCCACCCTCACCGCCATTTTCAGCACCTCACACCCATCAAGGCGACCTGGCATTCACGGCACAACCTC
ATT
GTTGTGGGCCGATACCCAGATCCTAATCTTAAAAGTTGTGTTCCCTATGAACTAAGGACAATAGATG
TG
TTTGATGGAAGCTCAGGGAAGATGATGTGTCAGCTCTATGATCCAGGATACTCCGGTATTACTTCGCT
C
AATGAGTTCAATCCTATGGGAGACACACTGGCCTCTACTATGGGTTATCATATTCTCATTTGGAGCCAA
GAG
GAAGATGGGTCACAGAAAGATCATGAAAGACTATGA


Translation (432 aa):
MAPKKCPETQKSPDVAVLLRSKSRRGPQELEPEAKKLRVQGPVSSRTCESCCLLAELSSLQIPSRSSSIV
R
DLYQHKLGKATWSSLQQ
GLQKSFLHSLASYQVFRKAAPFDRRTTSLAWHPTHPSTLAVGSKGGDIMIWN
F
GIKDKPIFLKG
IGAGGSITGLKFNHLNTNQFFASSMEGTTRLQDFKGNILRVYTSSNSCKVWFCSLDVS
A
KSRVVVTGDNMGHVILLSTDGKE
LWNLRMHKKKVAHVALNPCCDWLLATASIDQTVKIWDLRQIKGKDS
F
LYSLPHRHPVNA
ACFSPDGARLLTTDQNNEIRVYSASQWDSPLNLISHPHRHFQHLTPIKATWHSRHNL
I
VVGRYPDPNLKSCVPYELRTIDVFDGSSGKMMCQLYDPGYSGITS
LNEFNPMGDTLASTMGYHILIWSQ
E
EDGSQKDHERL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser