NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16176.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16176.1 Public Mus musculus 2 Frzb 16 104 75 CCDS HistoryNCBI Gene:20378Re-query CCDS DB by CCDS ID:16176.1Re-query CCDS DB by GeneID:20378

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 16176.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028389 ENSMUSP00000028389 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028389Link to Ensembl Protein Viewer:ENSMUSP00000028389Re-query CCDS DB by Nucleotide ID:ENSMUST00000028389Re-query CCDS DB by Protein ID:ENSMUSP00000028389
Original member Current member EBI,WTSI OTTMUST00000032322 OTTMUSP00000014350 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000032322Link to Vega Protein Viewer:OTTMUSP00000014350Re-query CCDS DB by Nucleotide ID:OTTMUST00000032322Re-query CCDS DB by Protein ID:OTTMUSP00000014350
Original member Current member NCBI NM_011356.4 NP_035486.1 Accepted alive Link to Nucleotide Sequence:NM_011356.4Link to Protein Sequence:NP_035486.1Re-query CCDS DB by Nucleotide ID:NM_011356Re-query CCDS DB by Protein ID:NP_035486Link to BLink:NP_035486.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035486.1 323 P97401 323 100% 0 0

Chromosomal Locations for CCDS 16176.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

Chromosome Start Stop Links
2 80413362 80413472 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80417893 80417956 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80418312 80418516 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80424599 80424664 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80438495 80438542 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 80446363 80446840 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (972 nt):
ATGGTCTGCTGCGGCCCGGGACGGATGCTGCTAGGATGGGCCGGGTTGCTAGTCCTGGCTGCTCTCTGCC
TG
CTCCAGGTGCCCGGAGCTCAGGCTGCAGCCTGTGAGCCTGTCCGCATCCCGCTGTGCAAGTCCCTTCC
C
TGGAACATGACCAAGATGCCCAACCACCTGCACCACAGCACCCAGGCTAACGCCATCCTGGCCATGGAA
CAG
TTCGAAGGGCTGCTGGGCACCCACTGCAGCCCGGATCTTCTCTTCTTCCTCTGTGCAATGTACGCAC
CC
ATTTGCACCATCGACTTCCAGCACGAGCCCATCAAGCCCTGCAAGTCTGTGTGTGAGCGCGCCCGACA
G
GGCTGCGAGCCCATTCTCATCAAGTACCGCCACTCGTGGCCGGAAAGCTTGGCCTGCGACGAGCTGCCG
GTG
TACGACCGCGGCGTGTGCATCTCTCCTGAGGCCATCGTCACCGCGGACGGAGCGGATTTTCCTATGG
AT
TCAAGTACTGGACACTGCAGAGGGGCAAGCAGCGAACGTTGCAAATGTAAGCCTGTCAGAGCTACACA
G
AAGACCTATTTCCGGAACAATTACAACTATGTCATCCGGGCTAAAGTTAAAGAGGTAAAGATGAAATGT
CAT
GATGTGACCGCCGTTGTGGAAGTGAAGGAAATTCTAAAGGCATCACTGGTAAACATTCCAAGGGACA
CC
GTCAATCTTTATACCACCTCTGGCTGCCTCTGTCCTCCACTTACTGTCAATGAGGAATATGTCATCAT
G
GGCTATGAAGACGAGGAACGTTCCAGGTTACTCTTGGTAGAAGGCTCTATAGCTGAGAAGTGGAAGGAT
CGG
CTTGGTAAGAAAGTCAAGCGCTGGGATATGAAACTCCGACACCTTGGACTGGGTAAAACTGATGCTA
GC
GATTCCACTCAGAATCAGAAGTCTGGCAGGAACTCTAATCCCCGGCCAGCACGCAGCTAA


Translation (323 aa):
MVCCGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAME
Q
FEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPESLACDELP
V
YDRGVCISPEAIVTADGA
DFPMDSSTGHCRGASSERCKCKPVRATQKTYFRNNYNYVIRAKVKEVKMKC
H
DVTAVVEVKEILKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERS
RLLLVEGSIAEKWKD
R
LGKKVK
RWDMKLRHLGLGKTDASDSTQNQKSGRNSNPRPARS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser