NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15633.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15633.1 Public Mus musculus 1 A130010J15Rik 16 104 75 CCDS HistoryNCBI Gene:319266Re-query CCDS DB by CCDS ID:15633.1Re-query CCDS DB by GeneID:319266

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15633.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000110831 ENSMUSP00000106455 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110831Link to Ensembl Protein Viewer:ENSMUSP00000106455Re-query CCDS DB by Nucleotide ID:ENSMUST00000110831Re-query CCDS DB by Protein ID:ENSMUSP00000106455
Original member Current member EBI,WTSI ENSMUST00000161235 ENSMUSP00000124191 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000161235Link to Ensembl Protein Viewer:ENSMUSP00000124191Re-query CCDS DB by Nucleotide ID:ENSMUST00000161235Re-query CCDS DB by Protein ID:ENSMUSP00000124191
Original member Current member EBI,WTSI ENSMUST00000160822 ENSMUSP00000124546 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000160822Link to Ensembl Protein Viewer:ENSMUSP00000124546Re-query CCDS DB by Nucleotide ID:ENSMUST00000160822Re-query CCDS DB by Protein ID:ENSMUSP00000124546
Original member Current member EBI,WTSI ENSMUST00000178744 ENSMUSP00000136653 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000178744Link to Ensembl Protein Viewer:ENSMUSP00000136653Re-query CCDS DB by Nucleotide ID:ENSMUST00000178744Re-query CCDS DB by Protein ID:ENSMUSP00000136653
Original member Current member EBI,WTSI OTTMUST00000049171 OTTMUSP00000022735 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049171Link to Vega Protein Viewer:OTTMUSP00000022735Re-query CCDS DB by Nucleotide ID:OTTMUST00000049171Re-query CCDS DB by Protein ID:OTTMUSP00000022735
Original member Current member EBI,WTSI OTTMUST00000049172 OTTMUSP00000022736 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049172Link to Vega Protein Viewer:OTTMUSP00000022736Re-query CCDS DB by Nucleotide ID:OTTMUST00000049172Re-query CCDS DB by Protein ID:OTTMUSP00000022736
Original member Current member EBI,WTSI OTTMUST00000049173 OTTMUSP00000022737 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049173Link to Vega Protein Viewer:OTTMUSP00000022737Re-query CCDS DB by Nucleotide ID:OTTMUST00000049173Re-query CCDS DB by Protein ID:OTTMUSP00000022737
Original member Current member NCBI NM_001160359.1 NP_001153831.1 Accepted alive Link to Nucleotide Sequence:NM_001160359.1Link to Protein Sequence:NP_001153831.1Re-query CCDS DB by Nucleotide ID:NM_001160359Re-query CCDS DB by Protein ID:NP_001153831Link to BLink:NP_001153831.1
Original member Current member NCBI NM_001160360.1 NP_001153832.1 Accepted alive Link to Nucleotide Sequence:NM_001160360.1Link to Protein Sequence:NP_001153832.1Re-query CCDS DB by Nucleotide ID:NM_001160360Re-query CCDS DB by Protein ID:NP_001153832Link to BLink:NP_001153832.1
Original member Current member NCBI NM_181048.3 NP_851391.1 Accepted alive Link to Nucleotide Sequence:NM_181048.3Link to Protein Sequence:NP_851391.1Re-query CCDS DB by Nucleotide ID:NM_181048Re-query CCDS DB by Protein ID:NP_851391Link to BLink:NP_851391.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001153831.1 263 Q9DAE8 263 100% 0 0
NP_001153832.1 263 Q9DAE8 263 100% 0 0
NP_851391.1 263 Q9DAE8 263 100% 0 0

Chromosomal Locations for CCDS 15633.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 193174342 193175133 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (792 nt):
ATGTCAACACCAAGCCCTCAGCTGCTGGTGGCAGCTGCTCAGCAGACTCTGGGCATGGGCAAGAGAAAAT
GC
CCACCTCGAGCTACCTGCCTTCACCTGGCAGGAGAGGTGCTGGCTGTGGCCCGCGGGCTGAAGCCAGC
T
GTACTCTATGATTGCAACTCTGCAGGAGTATTGGCGCTCCAAAGTTATCTGGAGGAACTACAGGGGCTG
GGC
TTCCTGGAGCCAGGACTTCACATTCTTGAGATTGGAGAGAATAACTTTATTGTCAGTCCTGAGTATG
CC
TGTCAGCATTTGGAACAGACACTGCTTGGTACTGTAGCTTTCGTGGACGTTTCCCGCTCCCAACCTCA
T
CCTTCTGTCCGGTCGGTGGACCAGCTCCCGGACTTGAAATCTCTCATAGCTGACGTCATCACACGTTTT
CGA
GGACTTAAGAAAGATGTGTCTCAGGGAGTCTCCTACACCAGGCTACATTCCTCAGACTGGAATCTCT
GC
ACTGTATTTGGGATACTCCTGGGATATCCAGTCTCTTACACATTTGACCTGAACCGTGAAGATGACAA
C
TGCTTAACCATGACTCCCCTGCGGGTGTTTACTGCCCGGATTTCGTGGCTGCCTGGTCAACCATCAATT
CTG
CTGTACTCCTTTAGTGTTCCAGAGAGTTTGTTCCCAGCCCTGAAAAACTTTCTAAGTGCCTGGGAGA
AG
GAACTCAGAACCCGATTTAGGGCTCAGAATGCCTTTGCTGACCTCAGCATCTCCTCTGAGGTGGTCAC
A
CTTCCTGCTGTGGCCCTCTGA


Translation (263 aa):
MSTPSPQLLVAAAQQTLGMGKRKCPPRATCLHLAGEVLAVARGLKPAVLYDCNSAGVLALQSYLEELQGL
G
FLEPGLHILEIGENNFIVSPEYACQHLEQTLLGTVAFVDVSRSQPHPSVRSVDQLPDLKSLIADVITRF
R
GLKKDVSQGVSYTRLHSSDWNLCTVFGILLGYPVSYTFDLNREDDNCLTMTPLRVFTARISWLPGQPSI
L
LYSFSVPESLFPALKNFLSAWEKELRTRFRAQNAFADLSISSEVVTLPAVAL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser