NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15216.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15216.1 Public Mus musculus 1 Serpinb3b 16 104 75 CCDS HistoryNCBI Gene:383548Re-query CCDS DB by CCDS ID:15216.1Re-query CCDS DB by GeneID:383548

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 15216.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000086694 ENSMUSP00000083901 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000086694Link to Ensembl Protein Viewer:ENSMUSP00000083901Re-query CCDS DB by Nucleotide ID:ENSMUST00000086694Re-query CCDS DB by Protein ID:ENSMUSP00000083901
Original member Current member EBI,WTSI ENSMUST00000166100 ENSMUSP00000132370 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166100Link to Ensembl Protein Viewer:ENSMUSP00000132370Re-query CCDS DB by Nucleotide ID:ENSMUST00000166100Re-query CCDS DB by Protein ID:ENSMUSP00000132370
Original member Current member EBI,WTSI OTTMUST00000049655 OTTMUSP00000023041 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049655Link to Vega Protein Viewer:OTTMUSP00000023041Re-query CCDS DB by Nucleotide ID:OTTMUST00000049655Re-query CCDS DB by Protein ID:OTTMUSP00000023041
Original member Current member NCBI NM_198680.2 NP_941373.1 Accepted alive Link to Nucleotide Sequence:NM_198680.2Link to Protein Sequence:NP_941373.1Re-query CCDS DB by Nucleotide ID:NM_198680Re-query CCDS DB by Protein ID:NP_941373Link to BLink:NP_941373.1

Chromosomal Locations for CCDS 15216.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

Chromosome Start Stop Links
1 107154369 107154773 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 107155412 107155567 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 107155845 107155987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 107156830 107156947 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 107157668 107157790 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 107159021 107159077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 107159616 107159777 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1164 nt):
ATGATTCGTTTTCATGCAGCTGATGTTAAATTCGCAGTTGAAATGTACAGGCAGCTCAGAGAATCAGACA
AG
AACATTTTCTATTCCCCGATCAGCATGATGACAGCATTAGCAATGCTCCAGCTTGGAGCCAAAGGAAA
C
ACTGAAATACAAATTGAGAAGGTTCTTCAATTCATTGAAACCACCAAGAAGACAACAGAAAAATCTGAA
CAC
TGCGATGATGAAGAAAATGTCCATGAACAATTTCAAAAGCTTATAACTCAGTTAAACAAATCCAATG
AT
GATTATGACCTGAAGGCTGCCAACAGTATCTATGGAGCAAAGGGTTTCCCATTTCTCCAGACATTTTT
G
GAAGACATTAAGGAATATTATCAAGCTAAGGTGGAATCACTGGATTTCGAACATGCAACAGAAGAGAGC
GAA
AAGAAGATTAATTCCTGGGTGGAAAGCAAAACAAATGGAAAAATCAAAGACTTATTTCCTAGTGGGA
GC
CTAAGCAGTAGCACTATACTGGTTCTGGTGAATGCAGTGTATTTCAAAGGGCAATGGAATCGCAAATT
T
AATGAAAACCATACAAGAGAAGAAAAGTTTTGGCTGAACAAGAACACAAGTAAACCTGTCCAGATGATG
AAA
CAACGAAACAAATTTAACTTCAGCTTTCTGGGGGATGTGCACGCCCAGATTGTGGAAATACCATACA
AA
GGCAAAGATCTAAGTATGTTTGTCCTGCTGCCAATGGAAATTGATGGTCTGAAGCAGCTTGAAGAACA
A
CTCACTACTGACAAATTACTAGAGTGGATAAAAGCAGAAAACATGCATTTGACTGAGTTGTATTTATCT
TTG
CCTCGGTTCAAAGTGGAAGAGAAGTATGACCTCCAAGTTCCATTGGAACACATGGGGATGGTCGACG
CC
TTTGATCCACAGAAGGCTGACTTCTCTGGCATGAGCAGCATTCCAGGTCTTGTGGTGTCTAAAGTTTT
A
CACAAGTCCTTTGTGGAGGTGAATGAAGAGGGAACAGAAGCTGCTGCTGCCACAGGAGTGGAAGTCAGT
GTA
AGATCAGCACAGATAGCAGAAGATTTCTGTTGTGATCATCCATTCCTATTCTTCATCATTCACAGAA
TG
ACCAACAGCATCCTCTTCTTTGGCAGAATCTGCTCCCCTTAA


Translation (387 aa):
MIRFHAADVKFAVEMYRQLRESDKNIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQFIETTKKTTEKSE
H
CD
DEENVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPFLQTFLEDIKEYYQAKVESLDFEHATEES
E
KKINSWVESKTN
GKIKDLFPSGSLSSSTILVLVNAVYFKGQWNRKFNENHTREEKFWLNKNTSKPVQMM
K
QRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQ
LEEQLTTDKLLEWIKAENMHLTELYLS
L
PRFKVEEKYDLQVPLEHMGMVDAFDPQKADFSGMSSIPGLVVSKVLHKSFVEVNEEGTEAAAATGVEVS
V
RSAQIAEDFCCDHPFLFFIIHRMTNSILFFGRICSP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser