NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS14991.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14991.1 Public Mus musculus 1 Abi2 16 104 75 CCDS HistoryNCBI Gene:329165Re-query CCDS DB by CCDS ID:14991.1Re-query CCDS DB by GeneID:329165

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 14991.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000052332 ENSMUSP00000058754 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000052332Link to Ensembl Protein Viewer:ENSMUSP00000058754Re-query CCDS DB by Nucleotide ID:ENSMUST00000052332Re-query CCDS DB by Protein ID:ENSMUSP00000058754
Original member Current member NCBI NM_198127.2 NP_937760.1 Accepted alive Link to Nucleotide Sequence:NM_198127.2Link to Protein Sequence:NP_937760.1Re-query CCDS DB by Nucleotide ID:NM_198127Re-query CCDS DB by Protein ID:NP_937760Link to BLink:NP_937760.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_937760.1 446 P62484 446 100% 0 0

Chromosomal Locations for CCDS 14991.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

Chromosome Start Stop Links
1 60409803 60409919 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 60434243 60434410 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 60437056 60437232 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 60443985 60444082 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 60447260 60447406 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 60448078 60448202 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 60453604 60453762 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 60470666 60470839 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 60476740 60476915 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1341 nt):
ATGGCGGAGCTGCAGATGCTGCTGGAAGAGGAAATCCCGGGGGGCCGCCGGGCTCTCTTCGACAGCTACA
CG
AATCTGGAGCGGGTGGCCGACTACTGCGAGAATAACTACATCCAGTCACCAGATAAGCAGCGAGCCCT
A
GAAGAAACCAAAGCCTACACCACTCAATCCTTAGCAAGTGTTGCGTATCTGATAAACACCTTGGCCAAC
AAT
GTCCTACAGATGCTGGATATCCAGGCATCACAGTTACGGAGGATGGAGTCTTCAATCAACCATATTT
CA
CAAACAGTTGATATTCATAAAGAGAAGGTTGCAAGAAGAGAAATTGGTATTTTGACCACCAATAAAAA
C
ACTTCAAGGACCCATAAGATTATTGCGCCAGCCAACCTTGAGCGGCCAGTTCGTTATATTCGAAAACCT
ATT
GACTACACAATTTTAGATGACATTGGACATGGAGTGAAGGTGAGTACCCAGAATATGAAAATGGGTG
GA
TTGCCACGTACGACACCTCCAACTCAGAAGCCCCCAAGTCCCCCTATGTCAGGGAAGGGGACACTTGG
G
CGGCACTCCCCCTATCGAACACTGGAGCCAGTGCGTCCTCCAGTGGTACCAAATGATTACGTACCTAGC
CCA
ACCCGTAATATGGCTCCCTCGCAGCAGAGCCCTGTGAGGACAGCTTCTGTGAATCAAAGAAATCGAA
CT
TACAGCAGCAGTGGGAGCAGTGGAGGAAGTCACCCAAGTAGTCGGAGCAGCAGTCGGGAGAACAGCGG
A
AGTGGTAGTGTGGGGGTACCCATTGCTGTGCCTACTCCGTCTCCTCCAAGCGTCTTTCCAGGTCATCCT
GTT
CAGTTCTACAGCATGAACAGGCCTGCCTCTCGCCATACACCACCTACAATAGGGGGCTCGTTGCCCT
AT
AGACGTCCTCCTTCCATAACGTCACAAACAAGCCTTCAGAATCAGATGAATGGAGGTCCTTTTTATAA
C
CAGAATCCAGTTTCAGATACACCACCTCCACCCCCACCTGTGGAAGAGCCAGTCTTTGATGAATCCCCC
CCT
CCACCGCCTCCTCCAGAAGATTATGAAGAGGAGGAAGCAGCTGTGGTTGAGTACAGCGATCCGTACG
CT
GAAGAGGACCCACCGTGGGCGCCAAGGGCTTACTTGGAAAAGGTTGTGGCAATTTATGATTATACAAA
A
GACAAGGAAGATGAGCTGTCCTTTCAGGAAGGAGCCATTATATATGTCATCAAGAAGAATGACGATGGT
TGG
TATGAGGGAGTTATGAATGGTGTGACCGGGCTCTTCCCTGGGAACTATGTTGAGTCCATCATGCATT
AT
TCGGAGTAG


Translation (446 aa):
MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLAN
N
VLQMLDIQASQLRRMESSINHISQ
TVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKP
I
DYTILDDIGHGVK
VSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPS
P
TRNMAPSQQSPVRTASVNQRNRTY
SSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPGHP
V
QFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYNQNP
VSDTPPPPPPVEEPVFDESP
P
PPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRAYLEK
VVAIYDYTKDKEDELSFQEGAIIYVIKKNDDG
W
YEGVMNGVTGLFPGNYVESIMHYSE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser