NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS11501.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11501.1 Public Homo sapiens 17 MAPT 15 105 74 CCDS HistoryNCBI Gene:4137Re-query CCDS DB by CCDS ID:11501.1Re-query CCDS DB by GeneID:4137

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Sequence IDs included in CCDS 11501.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000262410 ENSP00000262410 Accepted alive Link to Ensembl Transcript Viewer:ENST00000262410Link to Ensembl Protein Viewer:ENSP00000262410Re-query CCDS DB by Nucleotide ID:ENST00000262410Re-query CCDS DB by Protein ID:ENSP00000262410
Original member Current member EBI,WTSI ENST00000571987 ENSP00000458742 Accepted alive Link to Ensembl Transcript Viewer:ENST00000571987Link to Ensembl Protein Viewer:ENSP00000458742Re-query CCDS DB by Nucleotide ID:ENST00000571987Re-query CCDS DB by Protein ID:ENSP00000458742
Original member Current member EBI,WTSI OTTHUMT00000440133 OTTHUMP00000258285 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000440133Link to Vega Protein Viewer:OTTHUMP00000258285Re-query CCDS DB by Nucleotide ID:OTTHUMT00000440133Re-query CCDS DB by Protein ID:OTTHUMP00000258285
Original member Current member NCBI NM_016835.4 NP_058519.3 Accepted alive Link to Nucleotide Sequence:NM_016835.4Link to Protein Sequence:NP_058519.3Re-query CCDS DB by Nucleotide ID:NM_016835Re-query CCDS DB by Protein ID:NP_058519Link to BLink:NP_058519.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058519.3 758 P10636-1 758 100% 0 0

Chromosomal Locations for CCDS 11501.1

Assembly GRCh37.p13 (GCF_000001405.25)

On '+' strand of Chromosome 17 (NC_000017.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

Chromosome Start Stop Links
17 44039704 44039836 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44049225 44049311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44051751 44051837 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44055741 44055806 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44060544 44061296 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44064406 44064461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44067244 44067441 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44068826 44068952 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44073765 44074030 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44087676 44087768 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44091609 44091690 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44095984 44096096 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 44101322 44101537 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternate exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2277 nt):
ATGGCTGAGCCCCGCCAGGAGTTCGAAGTGATGGAAGATCACGCTGGGACGTACGGGTTGGGGGACAGGA
AA
GATCAGGGGGGCTACACCATGCACCAAGACCAAGAGGGTGACACGGACGCTGGCCTGAAAGAATCTCC
C
CTGCAGACCCCCACTGAGGACGGATCTGAGGAACCGGGCTCTGAAACCTCTGATGCTAAGAGCACTCCA
ACA
GCGGAAGATGTGACAGCACCCTTAGTGGATGAGGGAGCTCCCGGCAAGCAGGCTGCCGCGCAGCCCC
AC
ACGGAGATCCCAGAAGGAACCACAGCTGAAGAAGCAGGCATTGGAGACACCCCCAGCCTGGAAGACGA
A
GCTGCTGGTCACGTGACCCAAGAGCCTGAAAGTGGTAAGGTGGTCCAGGAAGGCTTCCTCCGAGAGCCA
GGC
CCCCCAGGTCTGAGCCACCAGCTCATGTCCGGCATGCCTGGGGCTCCCCTCCTGCCTGAGGGCCCCA
GA
GAGGCCACACGCCAACCTTCGGGGACAGGACCTGAGGACACAGAGGGCGGCCGCCACGCCCCTGAGCT
G
CTCAAGCACCAGCTTCTAGGAGACCTGCACCAGGAGGGGCCGCCGCTGAAGGGGGCAGGGGGCAAAGAG
AGG
CCGGGGAGCAAGGAGGAGGTGGATGAAGACCGCGACGTCGATGAGTCCTCCCCCCAAGACTCCCCTC
CC
TCCAAGGCCTCCCCAGCCCAAGATGGGCGGCCTCCCCAGACAGCCGCCAGAGAAGCCACCAGCATCCC
A
GGCTTCCCAGCGGAGGGTGCCATCCCCCTCCCTGTGGATTTCCTCTCCAAAGTTTCCACAGAGATCCCA
GCC
TCAGAGCCCGACGGGCCCAGTGTAGGGCGGGCCAAAGGGCAGGATGCCCCCCTGGAGTTCACGTTTC
AC
GTGGAAATCACACCCAACGTGCAGAAGGAGCAGGCGCACTCGGAGGAGCATTTGGGAAGGGCTGCATT
T
CCAGGGGCCCCTGGAGAGGGGCCAGAGGCCCGGGGCCCCTCTTTGGGAGAGGACACAAAAGAGGCTGAC
CTT
CCAGAGCCCTCTGAAAAGCAGCCTGCTGCTGCTCCGCGGGGGAAGCCCGTCAGCCGGGTCCCTCAAC
TC
AAAGCTCGCATGGTCAGTAAAAGCAAAGACGGGACTGGAAGCGATGACAAAAAAGCCAAGACATCCAC
A
CGTTCCTCTGCTAAAACCTTGAAAAATAGGCCTTGCCTTAGCCCCAAACACCCCACTCCTGGTAGCTCA
GAC
CCTCTGATCCAACCCTCCAGCCCTGCTGTGTGCCCAGAGCCACCTTCCTCTCCTAAATACGTCTCTT
CT
GTCACTTCCCGAACTGGCAGTTCTGGAGCAAAGGAGATGAAACTCAAGGGGGCTGATGGTAAAACGAA
G
ATCGCCACACCGCGGGGAGCAGCCCCTCCAGGCCAGAAGGGCCAGGCCAACGCCACCAGGATTCCAGCA
AAA
ACCCCGCCCGCTCCAAAGACACCACCCAGCTCTGGTGAACCTCCAAAATCAGGGGATCGCAGCGGCT
AC
AGCAGCCCCGGCTCCCCAGGCACTCCCGGCAGCCGCTCCCGCACCCCGTCCCTTCCAACCCCACCCAC
C
CGGGAGCCCAAGAAGGTGGCAGTGGTCCGTACTCCACCCAAGTCGCCGTCTTCCGCCAAGAGCCGCCTG
CAG
ACAGCCCCCGTGCCCATGCCAGACCTGAAGAATGTCAAGTCCAAGATCGGCTCCACTGAGAACCTGA
AG
CACCAGCCGGGAGGCGGGAAGGTGCAGATAATTAATAAGAAGCTGGATCTTAGCAACGTCCAGTCCAA
G
TGTGGCTCAAAGGATAATATCAAACACGTCCCGGGAGGCGGCAGTGTGCAAATAGTCTACAAACCAGTT
GAC
CTGAGCAAGGTGACCTCCAAGTGTGGCTCATTAGGCAACATCCATCATAAACCAGGAGGTGGCCAGG
TG
GAAGTAAAATCTGAGAAGCTTGACTTCAAGGACAGAGTCCAGTCGAAGATTGGGTCCCTGGACAATAT
C
ACCCACGTCCCTGGCGGAGGAAATAAAAAGATTGAAACCCACAAGCTGACCTTCCGCGAGAACGCCAAA
GCC
AAGACAGACCACGGGGCGGAGATCGTGTACAAGTCGCCAGTGGTGTCTGGGGACACGTCTCCACGGC
AT
CTCAGCAATGTCTCCTCCACCGGCAGCATCGACATGGTAGACTCGCCCCAGCTCGCCACGCTAGCTGA
C
GAGGTGTCTGCCTCCCTGGCCAAGCAGGGTTTGTGA


Translation (758 aa):
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTP
T
AE
DVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREP
G
PPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKE
R
PGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIP
A
SEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEAD
L
PEPSEKQPAAAPRGKPVSRVPQLK
ARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
D
PLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLK
GADGKTKIATPRGAAPPGQKGQANATRIPA
K
TPPAPKTPPSS
GEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRL
Q
TAPVPMPDLKNVKSKIGSTENLKHQPGGGK
VQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPV
D
LSKVTSKCGSLGNIHHKP
GGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAK
A
KTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  UCSC Genome Browser
  VEGA Genome Browser