NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28289.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28289.1 Public Mus musculus 16 N6amt1 16 104 75 CCDS HistoryNCBI Gene:67768Re-query CCDS DB by CCDS ID:28289.1Re-query CCDS DB by GeneID:67768See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 28289.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000054442 ENSMUSP00000061835 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000054442Link to Ensembl Protein Viewer:ENSMUSP00000061835Re-query CCDS DB by Nucleotide ID:ENSMUST00000054442Re-query CCDS DB by Protein ID:ENSMUSP00000061835
Original member Current member EBI,WTSI OTTMUST00000065657 OTTMUSP00000032752 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000065657Link to Vega Protein Viewer:OTTMUSP00000032752Re-query CCDS DB by Nucleotide ID:OTTMUST00000065657Re-query CCDS DB by Protein ID:OTTMUSP00000032752
Original member Current member NCBI NM_026366.2 NP_080642.1 Accepted alive Link to Nucleotide Sequence:NM_026366.2Link to Protein Sequence:NP_080642.1Re-query CCDS DB by Nucleotide ID:NM_026366Re-query CCDS DB by Protein ID:NP_080642Link to BLink:NP_080642.1

Chromosomal Locations for CCDS 28289.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 87354253 87354386 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 87356178 87356264 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 87356898 87356988 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 87362520 87362603 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 87366139 87366280 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 87367465 87367571 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (645 nt):
ATGGCGGCGCCGAGTGTCCCCACGCCGTTGTACGGGCACGTGGGTCGCGGAGCCTTCCGCGACGTGTACG
AG
CCAGCGGAGGACACGTTCCTGTTACTGGACGCGCTCGAGGCGGCGGCGGCCGAGCTAGCAGGAGTGGA
A
ATATGCCTTGAAGTAGGAGCAGGATCTGGTGTGGTGTCTGCATTCCTGGCCTCCATGATAGGTCCTCGG
GCC
TTATACATGTGCACTGATATCAACCCTGAGGCAGCCGCATGTACCTTGGAAACAGCACGCTGTAACA
GA
GTCCATGTTCAGCCAGTGATCACAGATTTGGTGCACGGCTTGCTGCCCAGACTGAAGGGGAAAGTAGA
C
CTGCTGGTGTTTAACCCCCCCTATGTAGTGACTCCGCCTGAAGAGGTAGGAAGTCGTGGAATAGAAGCA
GCC
TGGGCTGGCGGCAGAAACGGCCGGGAAGTCATGGACAGGTTCTTCCCACTGGCTCCAGAACTCCTCT
CC
CCAAGAGGGCTGTTCTACTTAGTTACCGTAAAAGAAAACAATCCCGAGGAAATCTTTAAAACAATGAA
G
ACAAGAGGTCTGCAAGGGACCACAGCACTTTGCAGGCAAGCAGGCCAAGAAGCCCTGTCAGTCCTCAGG
TTC
AGCAAGTCCTAG


Translation (214 aa):
MAAPSVPTPLYGHVGRGAFRDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGAGSGVVSAFLASMIGPR
A
LY
MCTDINPEAAACTLETARCNRVHVQPVITDLVHGLLPRLKGKVDLLVFNPPYVVTPPEEVGSRGIEA
A
WAGGRNGREVMDRFFPLAPELLSPRGLFYLVTVKENNP
EEIFKTMKTRGLQGTTALCRQAGQEALSVLR
F
SKS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser